BLASTX nr result
ID: Akebia23_contig00006473
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00006473 (929 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpg|DAA48327.1| TPA: hypothetical protein ZEAMMB73_262778 [Zea m... 59 3e-06 ref|XP_004957362.1| PREDICTED: 60S ribosomal protein L38-like [S... 57 8e-06 >tpg|DAA48327.1| TPA: hypothetical protein ZEAMMB73_262778 [Zea mays] Length = 92 Score = 58.9 bits (141), Expect = 3e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 754 LHFCGRQPKQIHEIKDFLLTARRKDARSVKIKR 852 L FC PKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 18 LWFCTISPKQIHEIKDFLLTARRKDARSVKIKR 50 >ref|XP_004957362.1| PREDICTED: 60S ribosomal protein L38-like [Setaria italica] Length = 95 Score = 57.4 bits (137), Expect = 8e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 766 GRQPKQIHEIKDFLLTARRKDARSVKIKR 852 G+ PKQIHEIKDFLLTARRKDARSVKIKR Sbjct: 25 GKMPKQIHEIKDFLLTARRKDARSVKIKR 53