BLASTX nr result
ID: Akebia23_contig00005391
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00005391 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004971197.1| PREDICTED: uncharacterized protein LOC101779... 57 3e-06 >ref|XP_004971197.1| PREDICTED: uncharacterized protein LOC101779627 [Setaria italica] Length = 49 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 3/48 (6%) Frame = +3 Query: 90 MGKICCTELDDESSFSLLGLAVALILAMMLFVLCQPKRR---IKVYHC 224 MGK+CC++ DDE +F+LLGL V ++LA++L ++C P RR I VY C Sbjct: 1 MGKLCCSQEDDEPAFNLLGLLVTIVLALLLLMMCTPPRRRRCIAVYPC 48