BLASTX nr result
ID: Akebia23_contig00004199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00004199 (390 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEO13833.1| thiazole biosynthetic protein [Camellia sinensis] 80 2e-13 ref|XP_006452193.1| hypothetical protein CICLE_v10008765mg [Citr... 71 1e-10 ref|NP_001275783.1| thiamine thiazole synthase, chloroplastic [C... 71 1e-10 ref|XP_006467989.1| PREDICTED: thiamine thiazole synthase 2, chl... 70 3e-10 ref|XP_006449089.1| hypothetical protein CICLE_v10015727mg [Citr... 70 3e-10 gb|AFM35683.1| thiamin biosynthetic protein [Vitis pseudoreticul... 70 4e-10 ref|XP_007025992.1| Thiazole biosynthetic enzyme [Theobroma caca... 69 7e-10 gb|EYU33910.1| hypothetical protein MIMGU_mgv1a009148mg [Mimulus... 69 9e-10 ref|XP_004244150.1| PREDICTED: thiamine thiazole synthase 1, chl... 69 9e-10 ref|XP_002267414.1| PREDICTED: thiazole biosynthetic enzyme, chl... 69 9e-10 ref|XP_007021022.1| Thiazole biosynthetic enzyme, chloroplast (A... 66 6e-09 ref|XP_002317206.1| hypothetical protein POPTR_0011s00500g [Popu... 66 6e-09 ref|XP_006360084.1| PREDICTED: thiamine thiazole synthase 1, chl... 65 1e-08 ref|XP_002281769.1| PREDICTED: thiazole biosynthetic enzyme, chl... 65 1e-08 ref|XP_007143207.1| hypothetical protein PHAVU_007G052900g [Phas... 64 2e-08 gb|ADG27845.1| thiazole biosynthetic enzyme [Gossypium hirsutum] 64 2e-08 gb|EXC05099.1| Thiamine thiazole synthase 2 [Morus notabilis] 63 5e-08 ref|XP_002305603.1| hypothetical protein POPTR_0004s01990g [Popu... 63 5e-08 gb|AAP03875.1| putative chloroplast thiazole biosynthetic protei... 62 6e-08 ref|XP_002316981.2| hypothetical protein POPTR_0011s13820g [Popu... 62 8e-08 >gb|AEO13833.1| thiazole biosynthetic protein [Camellia sinensis] Length = 132 Score = 80.5 bits (197), Expect = 2e-13 Identities = 45/59 (76%), Positives = 50/59 (84%), Gaps = 3/59 (5%) Frame = +3 Query: 222 FLD-NQSSFHGIPII-PSRLQRIRSTPQNFSISMS-SSPPYDLQSFKFEPIKESIVSRE 389 FLD +QSSFHG+P+ P RLQ I+STP N SISMS SSPPYDL+SF FEPIKESIVSRE Sbjct: 20 FLDTHQSSFHGVPLSSPIRLQPIKSTPHNLSISMSASSPPYDLRSFTFEPIKESIVSRE 78 >ref|XP_006452193.1| hypothetical protein CICLE_v10008765mg [Citrus clementina] gi|557555419|gb|ESR65433.1| hypothetical protein CICLE_v10008765mg [Citrus clementina] Length = 356 Score = 71.2 bits (173), Expect = 1e-10 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 3/54 (5%) Frame = +3 Query: 237 SSFHGIPIIPS--RLQRIRST-PQNFSISMSSSPPYDLQSFKFEPIKESIVSRE 389 SSFHG P+ PS RLQ I+S+ P N SIS S+SPPYDL +FKF+PIKESIVSRE Sbjct: 23 SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSRE 76 >ref|NP_001275783.1| thiamine thiazole synthase, chloroplastic [Citrus sinensis] gi|6094476|sp|O23787.1|THI4_CITSI RecName: Full=Thiamine thiazole synthase, chloroplastic; AltName: Full=Thiazole biosynthetic enzyme; Flags: Precursor gi|2582665|emb|CAB05370.1| thi [Citrus sinensis] Length = 356 Score = 71.2 bits (173), Expect = 1e-10 Identities = 38/54 (70%), Positives = 44/54 (81%), Gaps = 3/54 (5%) Frame = +3 Query: 237 SSFHGIPIIPS--RLQRIRST-PQNFSISMSSSPPYDLQSFKFEPIKESIVSRE 389 SSFHG P+ PS RLQ I+S+ P N SIS S+SPPYDL +FKF+PIKESIVSRE Sbjct: 23 SSFHGAPMSPSLLRLQPIKSSRPNNLSISASASPPYDLNTFKFDPIKESIVSRE 76 >ref|XP_006467989.1| PREDICTED: thiamine thiazole synthase 2, chloroplastic-like [Citrus sinensis] Length = 359 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/58 (63%), Positives = 45/58 (77%), Gaps = 2/58 (3%) Frame = +3 Query: 222 FLDNQSSFHGIPIIPSRLQRIRSTPQN--FSISMSSSPPYDLQSFKFEPIKESIVSRE 389 FLD++SSFHG PII SR+ IRS+ Q+ +ISMS +P YD SF F+PIKESIVSRE Sbjct: 20 FLDHKSSFHGSPIITSRVTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSRE 77 >ref|XP_006449089.1| hypothetical protein CICLE_v10015727mg [Citrus clementina] gi|557551700|gb|ESR62329.1| hypothetical protein CICLE_v10015727mg [Citrus clementina] Length = 359 Score = 70.1 bits (170), Expect = 3e-10 Identities = 37/58 (63%), Positives = 45/58 (77%), Gaps = 2/58 (3%) Frame = +3 Query: 222 FLDNQSSFHGIPIIPSRLQRIRSTPQN--FSISMSSSPPYDLQSFKFEPIKESIVSRE 389 FLD++SSFHG PII SR+ IRS+ Q+ +ISMS +P YD SF F+PIKESIVSRE Sbjct: 20 FLDHKSSFHGSPIITSRVTPIRSSSQSQTHTISMSLTPQYDFNSFTFDPIKESIVSRE 77 >gb|AFM35683.1| thiamin biosynthetic protein [Vitis pseudoreticulata] Length = 355 Score = 69.7 bits (169), Expect = 4e-10 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = +3 Query: 222 FLDNQSSFHGIPIIPSRLQRIRSTPQNFSISMSSSPPYDLQSFKFEPIKESIVSRE 389 F DN+SSFHG PI R+ I+ + Q+ +ISMSS+ PYDLQSFKFEPIKESIV+RE Sbjct: 19 FFDNKSSFHGSPI-SYRVLPIKVSHQSPTISMSSASPYDLQSFKFEPIKESIVARE 73 >ref|XP_007025992.1| Thiazole biosynthetic enzyme [Theobroma cacao] gi|508781358|gb|EOY28614.1| Thiazole biosynthetic enzyme [Theobroma cacao] Length = 387 Score = 68.9 bits (167), Expect = 7e-10 Identities = 37/57 (64%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = +3 Query: 222 FLDNQSSFHGIPIIPSRLQRIRSTPQNFSISMS-SSPPYDLQSFKFEPIKESIVSRE 389 FLD++SSFHG PI SR IRS+ Q+ +ISMS ++PPYDLQSF F+PIKES V+RE Sbjct: 50 FLDHKSSFHGTPIA-SRFTPIRSSSQDSAISMSLNTPPYDLQSFNFQPIKESYVARE 105 >gb|EYU33910.1| hypothetical protein MIMGU_mgv1a009148mg [Mimulus guttatus] gi|604328243|gb|EYU33911.1| hypothetical protein MIMGU_mgv1a009148mg [Mimulus guttatus] Length = 351 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/57 (56%), Positives = 47/57 (82%), Gaps = 1/57 (1%) Frame = +3 Query: 222 FLDNQSSFHGIPIIPSRL-QRIRSTPQNFSISMSSSPPYDLQSFKFEPIKESIVSRE 389 F DN+S+FHG ++P+R Q I+STP+N +++M+S+P Y+L FKF+PIKESIV+RE Sbjct: 17 FFDNKSTFHGAAVVPTRAAQPIKSTPKNLAVAMASTP-YNLDDFKFQPIKESIVARE 72 >ref|XP_004244150.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Solanum lycopersicum] Length = 354 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/60 (61%), Positives = 49/60 (81%), Gaps = 4/60 (6%) Frame = +3 Query: 222 FLD-NQSSFHGIPIIP-SRLQRIRSTPQNFSISMSS--SPPYDLQSFKFEPIKESIVSRE 389 F+D ++SSF+G+PI +RL+ ++STPQN S+SMS+ SPPYDL SF F PIKESIV+RE Sbjct: 15 FIDTHKSSFYGVPISSQTRLKIVKSTPQNMSVSMSADASPPYDLGSFSFNPIKESIVARE 74 >ref|XP_002267414.1| PREDICTED: thiazole biosynthetic enzyme, chloroplastic [Vitis vinifera] gi|378524328|sp|F6H7K5.1|THI42_VITVI RecName: Full=Thiamine thiazole synthase 2, chloroplastic; AltName: Full=Thiazole biosynthetic enzyme 2; Flags: Precursor Length = 355 Score = 68.6 bits (166), Expect = 9e-10 Identities = 37/56 (66%), Positives = 44/56 (78%) Frame = +3 Query: 222 FLDNQSSFHGIPIIPSRLQRIRSTPQNFSISMSSSPPYDLQSFKFEPIKESIVSRE 389 F DN+SSFHG PI R+ I+ + Q+ +ISMSS PYDLQSFKFEPIKESIV+RE Sbjct: 19 FFDNKSSFHGSPI-SYRVLPIKVSHQSPTISMSSVSPYDLQSFKFEPIKESIVARE 73 >ref|XP_007021022.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) [Theobroma cacao] gi|508720650|gb|EOY12547.1| Thiazole biosynthetic enzyme, chloroplast (ARA6) (THI1) (THI4) [Theobroma cacao] Length = 358 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/56 (58%), Positives = 43/56 (76%), Gaps = 4/56 (7%) Frame = +3 Query: 234 QSSFHGIPIIPSRLQ-RIRSTPQNFSISMS---SSPPYDLQSFKFEPIKESIVSRE 389 +SSFHG+PI P + +S+P+N S+SMS S PPYDL +F+F+PIKESIVSRE Sbjct: 23 ESSFHGVPITPLSFHLKAKSSPRNASVSMSAASSPPPYDLNNFRFDPIKESIVSRE 78 >ref|XP_002317206.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa] gi|222860271|gb|EEE97818.1| hypothetical protein POPTR_0011s00500g [Populus trichocarpa] Length = 350 Score = 65.9 bits (159), Expect = 6e-09 Identities = 36/57 (63%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = +3 Query: 222 FLDNQSSFHGIPIIPS-RLQRIRSTPQNFSISMSSSPPYDLQSFKFEPIKESIVSRE 389 FLDN+SSFHG PI + R I+ST S+S++ P YDLQSFKF+PIKESIVSRE Sbjct: 17 FLDNKSSFHGTPITTTTRFTPIKSTSPAISMSLTQ-PSYDLQSFKFQPIKESIVSRE 72 >ref|XP_006360084.1| PREDICTED: thiamine thiazole synthase 1, chloroplastic-like [Solanum tuberosum] Length = 357 Score = 64.7 bits (156), Expect = 1e-08 Identities = 35/63 (55%), Positives = 48/63 (76%), Gaps = 7/63 (11%) Frame = +3 Query: 222 FLD-NQSSFHGIPIIP-SRLQRIRSTPQNFSISMSSS-----PPYDLQSFKFEPIKESIV 380 F+D ++SSF+G+PI +RL+ ++STPQN ++SMS+ PPYDL SF F PIKESIV Sbjct: 15 FIDTHKSSFYGVPISSQARLKIVKSTPQNMAVSMSADASPPPPPYDLGSFSFNPIKESIV 74 Query: 381 SRE 389 +RE Sbjct: 75 ARE 77 >ref|XP_002281769.1| PREDICTED: thiazole biosynthetic enzyme, chloroplastic isoform 1 [Vitis vinifera] gi|359494007|ref|XP_003634708.1| PREDICTED: thiazole biosynthetic enzyme, chloroplastic [Vitis vinifera] gi|378524288|sp|F6H9A9.1|THI41_VITVI RecName: Full=Thiamine thiazole synthase 1, chloroplastic; AltName: Full=Thiazole biosynthetic enzyme 1; Flags: Precursor Length = 353 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/57 (57%), Positives = 46/57 (80%), Gaps = 1/57 (1%) Frame = +3 Query: 222 FLDNQSSFHGIPIIP-SRLQRIRSTPQNFSISMSSSPPYDLQSFKFEPIKESIVSRE 389 F ++SSFHG+PI +RL ++STP N +++ +++ PYDL+SFKFEPIKESIVSRE Sbjct: 17 FDPHKSSFHGVPIATQARLSPVKSTPVNLAVT-AAAMPYDLRSFKFEPIKESIVSRE 72 >ref|XP_007143207.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris] gi|561016397|gb|ESW15201.1| hypothetical protein PHAVU_007G052900g [Phaseolus vulgaris] Length = 355 Score = 64.3 bits (155), Expect = 2e-08 Identities = 35/58 (60%), Positives = 45/58 (77%), Gaps = 2/58 (3%) Frame = +3 Query: 222 FLDNQ-SSFHGIPIIPSRLQRIRSTPQNFSISMS-SSPPYDLQSFKFEPIKESIVSRE 389 F D++ +SFHG P+ SRL +S+ + +ISMS + PPYDLQSFKF+PIKESIVSRE Sbjct: 17 FFDHKPTSFHGKPVSQSRLTPTKSSSKQPTISMSLTPPPYDLQSFKFQPIKESIVSRE 74 >gb|ADG27845.1| thiazole biosynthetic enzyme [Gossypium hirsutum] Length = 357 Score = 64.3 bits (155), Expect = 2e-08 Identities = 34/55 (61%), Positives = 42/55 (76%), Gaps = 3/55 (5%) Frame = +3 Query: 234 QSSFHGIPIIPSRLQ-RIRSTPQNFSISMS--SSPPYDLQSFKFEPIKESIVSRE 389 +SSFHG+PI P + +S+P N SISMS S PPYDL +F+F+PIKESIVSRE Sbjct: 23 ESSFHGVPIKPLSFHFKTKSSPCNASISMSAASPPPYDLNNFRFDPIKESIVSRE 77 >gb|EXC05099.1| Thiamine thiazole synthase 2 [Morus notabilis] Length = 353 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/55 (54%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = +3 Query: 228 DNQSSFHGIPIIPSR-LQRIRSTPQNFSISMSSSPPYDLQSFKFEPIKESIVSRE 389 ++ SSFHG P+ P R++ FS+SMS++ PYDL++F+FEPIKESIVSRE Sbjct: 18 ESSSSFHGTPLAPPPPCLRLQPAKAGFSVSMSAAAPYDLKNFRFEPIKESIVSRE 72 >ref|XP_002305603.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa] gi|118486164|gb|ABK94925.1| unknown [Populus trichocarpa] gi|222848567|gb|EEE86114.1| hypothetical protein POPTR_0004s01990g [Populus trichocarpa] Length = 350 Score = 62.8 bits (151), Expect = 5e-08 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = +3 Query: 222 FLDNQSSFHGIPIIPS-RLQRIRSTPQNFSISMSSSPPYDLQSFKFEPIKESIVSRE 389 FLD++SSFHG PI + R I+ST ++S++ P YDLQSFKF+PIKESIVSRE Sbjct: 17 FLDHKSSFHGTPITTTGRFTPIKSTSPAITMSLTQ-PSYDLQSFKFQPIKESIVSRE 72 >gb|AAP03875.1| putative chloroplast thiazole biosynthetic protein [Nicotiana tabacum] Length = 358 Score = 62.4 bits (150), Expect = 6e-08 Identities = 35/61 (57%), Positives = 45/61 (73%), Gaps = 5/61 (8%) Frame = +3 Query: 222 FLD-NQSSFHGIPIIP-SRLQRIRSTPQNFSISMS---SSPPYDLQSFKFEPIKESIVSR 386 FLD ++SSF G+P+ +RL+ ++S QN +ISMS S PPYDL +F F PIKESIVSR Sbjct: 18 FLDTHKSSFSGVPLFSQARLKPVKSAQQNMTISMSADSSPPPYDLNAFSFNPIKESIVSR 77 Query: 387 E 389 E Sbjct: 78 E 78 >ref|XP_002316981.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa] gi|118486174|gb|ABK94930.1| unknown [Populus trichocarpa] gi|550328344|gb|EEE97593.2| hypothetical protein POPTR_0011s13820g [Populus trichocarpa] Length = 357 Score = 62.0 bits (149), Expect = 8e-08 Identities = 37/57 (64%), Positives = 41/57 (71%), Gaps = 3/57 (5%) Frame = +3 Query: 228 DNQSSFHGIPIIPS--RLQRIRSTPQ-NFSISMSSSPPYDLQSFKFEPIKESIVSRE 389 D SSFHG PI R+Q +S+ N SISMSS PPYDL +FKFEPIKESIVSRE Sbjct: 22 DTSSSFHGTPISKPTLRMQPTKSSSSPNVSISMSS-PPYDLNAFKFEPIKESIVSRE 77