BLASTX nr result
ID: Akebia23_contig00003387
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00003387 (278 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006491232.1| PREDICTED: mitochondrial carrier protein MTM... 84 3e-14 ref|XP_006444889.1| hypothetical protein CICLE_v10021414mg [Citr... 84 3e-14 gb|EYU19620.1| hypothetical protein MIMGU_mgv1a007128mg [Mimulus... 81 1e-13 ref|XP_004160368.1| PREDICTED: solute carrier family 25 member 3... 81 2e-13 ref|XP_004145920.1| PREDICTED: solute carrier family 25 member 3... 81 2e-13 ref|XP_003626546.1| Calcium-binding mitochondrial carrier protei... 80 2e-13 ref|XP_007051630.1| Mitochondrial substrate carrier family prote... 80 4e-13 ref|XP_006374330.1| mitochondrial substrate carrier family prote... 79 5e-13 ref|XP_006350590.1| PREDICTED: mitochondrial carrier protein MTM... 79 7e-13 ref|XP_004234182.1| PREDICTED: solute carrier family 25 member 3... 79 7e-13 ref|XP_006577339.1| PREDICTED: mitochondrial carrier protein MTM... 79 9e-13 ref|XP_003521796.1| PREDICTED: mitochondrial carrier protein MTM... 79 9e-13 ref|XP_002532656.1| mitochondrial carrier protein, putative [Ric... 79 9e-13 ref|XP_006604882.1| PREDICTED: mitochondrial carrier protein MTM... 78 1e-12 tpg|DAA49072.1| TPA: hypothetical protein ZEAMMB73_432177 [Zea m... 78 1e-12 ref|XP_003554754.1| PREDICTED: mitochondrial carrier protein MTM... 78 1e-12 ref|XP_003602191.1| Calcium-binding mitochondrial carrier protei... 78 1e-12 ref|NP_001183916.1| hypothetical protein [Zea mays] gi|238015420... 78 1e-12 ref|XP_002513593.1| mitochondrial carrier protein, putative [Ric... 78 1e-12 ref|XP_006578936.1| PREDICTED: mitochondrial carrier protein MTM... 78 1e-12 >ref|XP_006491232.1| PREDICTED: mitochondrial carrier protein MTM1-like [Citrus sinensis] Length = 401 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 LME+WRDGGMKGLFTG+ PRVAR GPSVGIVVSFYEV+K+ L Q+H Sbjct: 352 LMEIWRDGGMKGLFTGVGPRVARAGPSVGIVVSFYEVVKYALYQRH 397 >ref|XP_006444889.1| hypothetical protein CICLE_v10021414mg [Citrus clementina] gi|567904804|ref|XP_006444890.1| hypothetical protein CICLE_v10021414mg [Citrus clementina] gi|557547151|gb|ESR58129.1| hypothetical protein CICLE_v10021414mg [Citrus clementina] gi|557547152|gb|ESR58130.1| hypothetical protein CICLE_v10021414mg [Citrus clementina] Length = 296 Score = 83.6 bits (205), Expect = 3e-14 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 LME+WRDGGMKGLFTG+ PRVAR GPSVGIVVSFYEV+K+ L Q+H Sbjct: 247 LMEIWRDGGMKGLFTGVGPRVARAGPSVGIVVSFYEVVKYALYQRH 292 >gb|EYU19620.1| hypothetical protein MIMGU_mgv1a007128mg [Mimulus guttatus] Length = 418 Score = 81.3 bits (199), Expect = 1e-13 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L+EVWRDGGMKGLFTG+ PRV R GPSVGIV+SFYEV+KH+L+ ++ Sbjct: 370 LLEVWRDGGMKGLFTGVGPRVGRAGPSVGIVISFYEVVKHVLHHQY 415 >ref|XP_004160368.1| PREDICTED: solute carrier family 25 member 39-like [Cucumis sativus] Length = 421 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 LMEVWRDGGMKGLF G+ PRV R GPSVGIVVSFYEV+K++LN+++ Sbjct: 371 LMEVWRDGGMKGLFAGVGPRVGRAGPSVGIVVSFYEVVKYVLNRQY 416 >ref|XP_004145920.1| PREDICTED: solute carrier family 25 member 39-like [Cucumis sativus] Length = 421 Score = 80.9 bits (198), Expect = 2e-13 Identities = 35/46 (76%), Positives = 42/46 (91%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 LMEVWRDGGMKGLF G+ PRV R GPSVGIVVSFYEV+K++LN+++ Sbjct: 371 LMEVWRDGGMKGLFAGVGPRVGRAGPSVGIVVSFYEVVKYVLNRQY 416 >ref|XP_003626546.1| Calcium-binding mitochondrial carrier protein [Medicago truncatula] gi|355501561|gb|AES82764.1| Calcium-binding mitochondrial carrier protein [Medicago truncatula] Length = 354 Score = 80.5 bits (197), Expect = 2e-13 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L+E+WRDGG++GLFTGI+PRV R GPSVGIVVSFYEV+K+ LN +H Sbjct: 305 LLEIWRDGGLRGLFTGIAPRVGRAGPSVGIVVSFYEVVKYALNDRH 350 >ref|XP_007051630.1| Mitochondrial substrate carrier family protein [Theobroma cacao] gi|508703891|gb|EOX95787.1| Mitochondrial substrate carrier family protein [Theobroma cacao] Length = 399 Score = 79.7 bits (195), Expect = 4e-13 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L+E+WRDGGMKGLFTG+ PRV R GPSVGIVVSFYEV+K+ L+ +H Sbjct: 350 LLEIWRDGGMKGLFTGLGPRVGRAGPSVGIVVSFYEVVKYALHSRH 395 >ref|XP_006374330.1| mitochondrial substrate carrier family protein [Populus trichocarpa] gi|550322089|gb|ERP52127.1| mitochondrial substrate carrier family protein [Populus trichocarpa] Length = 418 Score = 79.3 bits (194), Expect = 5e-13 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 LMEVWRDGGM+ LFTG+ PRV R GPSVGIVVSFYEV+KH+L+ ++ Sbjct: 369 LMEVWRDGGMRALFTGVGPRVGRAGPSVGIVVSFYEVVKHLLHHRY 414 >ref|XP_006350590.1| PREDICTED: mitochondrial carrier protein MTM1-like isoform X1 [Solanum tuberosum] gi|565367897|ref|XP_006350591.1| PREDICTED: mitochondrial carrier protein MTM1-like isoform X2 [Solanum tuberosum] gi|565367899|ref|XP_006350592.1| PREDICTED: mitochondrial carrier protein MTM1-like isoform X3 [Solanum tuberosum] Length = 416 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/46 (71%), Positives = 43/46 (93%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L+E+WRDGG+KGLFTG+ PRV R GPSVGIVVSFYEV+K++L+Q++ Sbjct: 368 LLEIWRDGGLKGLFTGVGPRVGRAGPSVGIVVSFYEVVKYMLHQQY 413 >ref|XP_004234182.1| PREDICTED: solute carrier family 25 member 39-like [Solanum lycopersicum] Length = 416 Score = 79.0 bits (193), Expect = 7e-13 Identities = 33/46 (71%), Positives = 43/46 (93%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L+E+WRDGG+KGLFTG+ PRV R GPSVGIVVSFYEV+K++L+Q++ Sbjct: 368 LLEIWRDGGLKGLFTGVGPRVGRAGPSVGIVVSFYEVVKYMLHQQY 413 >ref|XP_006577339.1| PREDICTED: mitochondrial carrier protein MTM1-like isoform X2 [Glycine max] Length = 350 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/46 (69%), Positives = 42/46 (91%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L+E+WRDGG++GLFTG++PRV R GPSVGIVVSFYEV+K++L +H Sbjct: 303 LLEIWRDGGLRGLFTGVAPRVGRAGPSVGIVVSFYEVVKYVLQLRH 348 >ref|XP_003521796.1| PREDICTED: mitochondrial carrier protein MTM1-like isoform X1 [Glycine max] Length = 357 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/46 (69%), Positives = 42/46 (91%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L+E+WRDGG++GLFTG++PRV R GPSVGIVVSFYEV+K++L +H Sbjct: 310 LLEIWRDGGLRGLFTGVAPRVGRAGPSVGIVVSFYEVVKYVLQLRH 355 >ref|XP_002532656.1| mitochondrial carrier protein, putative [Ricinus communis] gi|223527616|gb|EEF29729.1| mitochondrial carrier protein, putative [Ricinus communis] Length = 358 Score = 78.6 bits (192), Expect = 9e-13 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQ 145 L EVWRDGG +GLFTGI PRVAR GPSVGIVVSFYEV+K+ LNQ Sbjct: 315 LQEVWRDGGFRGLFTGIGPRVARAGPSVGIVVSFYEVVKYTLNQ 358 >ref|XP_006604882.1| PREDICTED: mitochondrial carrier protein MTM1-like isoform X2 [Glycine max] Length = 351 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L+E+WRDGG++GLFTG+ PRV R GPSVGIVVSFYEV+K++L +H Sbjct: 302 LLEIWRDGGLRGLFTGVGPRVGRAGPSVGIVVSFYEVVKYVLQLRH 347 >tpg|DAA49072.1| TPA: hypothetical protein ZEAMMB73_432177 [Zea mays] Length = 397 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L E+WR GG+KGLFTG+ PRVAR GPSVGIVVSFYEV+K+ ++Q+H Sbjct: 350 LTEIWRSGGLKGLFTGVGPRVARAGPSVGIVVSFYEVVKYAIHQRH 395 >ref|XP_003554754.1| PREDICTED: mitochondrial carrier protein MTM1-like isoform X1 [Glycine max] Length = 346 Score = 78.2 bits (191), Expect = 1e-12 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L+E+WRDGG++GLFTG+ PRV R GPSVGIVVSFYEV+K++L +H Sbjct: 297 LLEIWRDGGLRGLFTGVGPRVGRAGPSVGIVVSFYEVVKYVLQLRH 342 >ref|XP_003602191.1| Calcium-binding mitochondrial carrier protein SCaMC-2 [Medicago truncatula] gi|355491239|gb|AES72442.1| Calcium-binding mitochondrial carrier protein SCaMC-2 [Medicago truncatula] Length = 394 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQK 142 LME+WRDGG+KGLFTG PRV R GPSVGIVVSFYEV+K +LN + Sbjct: 346 LMEIWRDGGLKGLFTGFGPRVGRAGPSVGIVVSFYEVVKFVLNHR 390 >ref|NP_001183916.1| hypothetical protein [Zea mays] gi|238015420|gb|ACR38745.1| unknown [Zea mays] gi|414870516|tpg|DAA49073.1| TPA: hypothetical protein ZEAMMB73_432177 [Zea mays] Length = 399 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 L E+WR GG+KGLFTG+ PRVAR GPSVGIVVSFYEV+K+ ++Q+H Sbjct: 352 LTEIWRSGGLKGLFTGVGPRVARAGPSVGIVVSFYEVVKYAIHQRH 397 >ref|XP_002513593.1| mitochondrial carrier protein, putative [Ricinus communis] gi|223547501|gb|EEF48996.1| mitochondrial carrier protein, putative [Ricinus communis] Length = 416 Score = 78.2 bits (191), Expect = 1e-12 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 LME+WRDGGMK LFTG+ PRV R GPSVGIVVSFYEV+K++L+ ++ Sbjct: 368 LMEIWRDGGMKALFTGVGPRVGRAGPSVGIVVSFYEVVKYVLHNRY 413 >ref|XP_006578936.1| PREDICTED: mitochondrial carrier protein MTM1-like isoform X3 [Glycine max] Length = 384 Score = 77.8 bits (190), Expect = 1e-12 Identities = 33/46 (71%), Positives = 41/46 (89%) Frame = -3 Query: 276 LMEVWRDGGMKGLFTGISPRVARTGPSVGIVVSFYEVMKHILNQKH 139 LMEVWRDGG+KGLFTG+ PRV R GPSVGIV+SFYEV+K +L+ ++ Sbjct: 338 LMEVWRDGGLKGLFTGVGPRVGRAGPSVGIVISFYEVVKFVLHHQY 383