BLASTX nr result
ID: Akebia23_contig00003124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00003124 (661 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138960.1| PREDICTED: uncharacterized protein LOC101214... 75 1e-11 ref|XP_002885614.1| hypothetical protein ARALYDRAFT_898961 [Arab... 75 1e-11 ref|XP_002521083.1| conserved hypothetical protein [Ricinus comm... 75 1e-11 ref|XP_006373059.1| hypothetical protein POPTR_0017s08260g [Popu... 75 1e-11 ref|XP_006493051.1| PREDICTED: putative SERF-like protein-like [... 75 2e-11 ref|XP_006420916.1| hypothetical protein CICLE_v10006390mg [Citr... 75 2e-11 ref|NP_189052.2| uncharacterized protein [Arabidopsis thaliana] ... 75 2e-11 ref|XP_006602502.1| PREDICTED: uncharacterized LOC100305502 [Gly... 74 3e-11 ref|XP_006418800.1| hypothetical protein EUTSA_v10002785mg, part... 74 4e-11 ref|XP_006285111.1| hypothetical protein CARUB_v10006444mg [Caps... 73 7e-11 ref|XP_007223554.1| hypothetical protein PRUPE_ppa014532mg [Prun... 73 7e-11 gb|ACU14753.1| unknown [Glycine max] 73 9e-11 dbj|BAB01351.1| unnamed protein product [Arabidopsis thaliana] 73 9e-11 gb|EYU39195.1| hypothetical protein MIMGU_mgv1a017500mg [Mimulus... 72 1e-10 ref|XP_007049759.1| Uncharacterized protein isoform 1 [Theobroma... 72 2e-10 gb|EXC25119.1| hypothetical protein L484_003043 [Morus notabilis] 72 2e-10 ref|XP_006414978.1| hypothetical protein EUTSA_v10026728mg [Eutr... 72 2e-10 ref|XP_006375240.1| hypothetical protein POPTR_0014s05560g [Popu... 71 3e-10 ref|XP_007140621.1| hypothetical protein PHAVU_008G127600g [Phas... 71 3e-10 ref|XP_004242406.1| PREDICTED: putative SERF-like protein-like [... 71 3e-10 >ref|XP_004138960.1| PREDICTED: uncharacterized protein LOC101214231 [Cucumis sativus] gi|449526243|ref|XP_004170123.1| PREDICTED: uncharacterized protein LOC101231850 [Cucumis sativus] Length = 68 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 RGNQRE+DRERA AR G K K KDDGLTPEQRRERDAKALQE Sbjct: 3 RGNQREKDRERAQARNGGKGKNKDDGLTPEQRRERDAKALQE 44 >ref|XP_002885614.1| hypothetical protein ARALYDRAFT_898961 [Arabidopsis lyrata subsp. lyrata] gi|297331454|gb|EFH61873.1| hypothetical protein ARALYDRAFT_898961 [Arabidopsis lyrata subsp. lyrata] Length = 149 Score = 75.5 bits (184), Expect = 1e-11 Identities = 37/49 (75%), Positives = 39/49 (79%) Frame = +1 Query: 166 YKXXXXXRGNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 Y G+QRERDRERA+AR G K KTKDDGLTPEQRRERDAKALQE Sbjct: 78 YNNWKTQEGSQRERDRERALARTGGKGKTKDDGLTPEQRRERDAKALQE 126 >ref|XP_002521083.1| conserved hypothetical protein [Ricinus communis] gi|223539652|gb|EEF41234.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 75.5 bits (184), Expect = 1e-11 Identities = 38/43 (88%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKT-KDDGLTPEQRRERDAKALQE 312 RGNQRERDRERA AR G KPK KDDGLTPEQRRERDAKALQE Sbjct: 12 RGNQRERDRERAQARAGQKPKNPKDDGLTPEQRRERDAKALQE 54 >ref|XP_006373059.1| hypothetical protein POPTR_0017s08260g [Populus trichocarpa] gi|118482809|gb|ABK93321.1| unknown [Populus trichocarpa] gi|550319760|gb|ERP50856.1| hypothetical protein POPTR_0017s08260g [Populus trichocarpa] Length = 68 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 RGNQRE+DRERA AR G K K KDDGLTPEQRRERDAKALQE Sbjct: 3 RGNQREKDRERAQARNGGKGKNKDDGLTPEQRRERDAKALQE 44 >ref|XP_006493051.1| PREDICTED: putative SERF-like protein-like [Citrus sinensis] Length = 66 Score = 75.1 bits (183), Expect = 2e-11 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 RGNQRERDRERA ARG SK KTKDDGLTPEQRRERDAKALQE Sbjct: 3 RGNQRERDRERAAARG-SKGKTKDDGLTPEQRRERDAKALQE 43 >ref|XP_006420916.1| hypothetical protein CICLE_v10006390mg [Citrus clementina] gi|557522789|gb|ESR34156.1| hypothetical protein CICLE_v10006390mg [Citrus clementina] Length = 66 Score = 75.1 bits (183), Expect = 2e-11 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 RGNQRERDRERA ARG SK KTKDDGLTPEQRRERDAKALQE Sbjct: 3 RGNQRERDRERAAARG-SKGKTKDDGLTPEQRRERDAKALQE 43 >ref|NP_189052.2| uncharacterized protein [Arabidopsis thaliana] gi|13878137|gb|AAK44146.1|AF370331_1 unknown protein [Arabidopsis thaliana] gi|23296709|gb|AAN13152.1| unknown protein [Arabidopsis thaliana] gi|332643336|gb|AEE76857.1| uncharacterized protein AT3G24100 [Arabidopsis thaliana] Length = 69 Score = 74.7 bits (182), Expect = 2e-11 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 RG+QRERDRERA+AR G K K KDDGLTPEQRRERDAKALQE Sbjct: 3 RGSQRERDRERALARTGGKGKNKDDGLTPEQRRERDAKALQE 44 >ref|XP_006602502.1| PREDICTED: uncharacterized LOC100305502 [Glycine max] Length = 64 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/42 (85%), Positives = 37/42 (88%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 RGNQR+RDRERA AR G K K KDDGLTPEQRRERDAKALQE Sbjct: 3 RGNQRDRDRERAQARTGGKGKQKDDGLTPEQRRERDAKALQE 44 >ref|XP_006418800.1| hypothetical protein EUTSA_v10002785mg, partial [Eutrema salsugineum] gi|557096728|gb|ESQ37236.1| hypothetical protein EUTSA_v10002785mg, partial [Eutrema salsugineum] Length = 128 Score = 73.9 bits (180), Expect = 4e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +1 Query: 190 GNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 G+QRERDRERA AR G K KTKDDGLTPEQRRERDAKALQE Sbjct: 62 GSQRERDRERAQARTGGKGKTKDDGLTPEQRRERDAKALQE 102 >ref|XP_006285111.1| hypothetical protein CARUB_v10006444mg [Capsella rubella] gi|482553816|gb|EOA18009.1| hypothetical protein CARUB_v10006444mg [Capsella rubella] Length = 134 Score = 73.2 bits (178), Expect = 7e-11 Identities = 46/87 (52%), Positives = 51/87 (58%), Gaps = 2/87 (2%) Frame = +1 Query: 58 LWPSTAILQTRTDLSIFNPLQGEKVSSSHLSIIYHAYKXXXXX-RGNQRERDRERAMARG 234 L P ++ + D IF SS H I Y RGNQRERDRERA ARG Sbjct: 21 LCPLCSLSIYKNDDHIFFVSSSSSSSSPHDLTITKPYSLLLCSKRGNQRERDRERAQARG 80 Query: 235 GSKPKT-KDDGLTPEQRRERDAKALQE 312 KPK K+DGLTPEQRRERDA+ALQE Sbjct: 81 NHKPKQPKNDGLTPEQRRERDARALQE 107 >ref|XP_007223554.1| hypothetical protein PRUPE_ppa014532mg [Prunus persica] gi|462420490|gb|EMJ24753.1| hypothetical protein PRUPE_ppa014532mg [Prunus persica] Length = 64 Score = 73.2 bits (178), Expect = 7e-11 Identities = 37/42 (88%), Positives = 38/42 (90%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 RGNQRE+DRERA ARGG K K KDDGLTPEQRRERDAKALQE Sbjct: 3 RGNQREKDRERAQARGG-KGKNKDDGLTPEQRRERDAKALQE 43 >gb|ACU14753.1| unknown [Glycine max] Length = 64 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 RG+QR+RDRERA AR G+K K KDDGLTPEQRRERDAKALQE Sbjct: 3 RGSQRDRDRERAQARTGAKGKQKDDGLTPEQRRERDAKALQE 44 >dbj|BAB01351.1| unnamed protein product [Arabidopsis thaliana] Length = 104 Score = 72.8 bits (177), Expect = 9e-11 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = +1 Query: 190 GNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 G+QRERDRERA+AR G K K KDDGLTPEQRRERDAKALQE Sbjct: 39 GSQRERDRERALARTGGKGKNKDDGLTPEQRRERDAKALQE 79 >gb|EYU39195.1| hypothetical protein MIMGU_mgv1a017500mg [Mimulus guttatus] Length = 71 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/43 (81%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKT-KDDGLTPEQRRERDAKALQE 312 RGNQR+RDRERA AR G+KP+ +DDGLTPEQRRERDAKALQE Sbjct: 3 RGNQRDRDRERAQARSGTKPRNPRDDGLTPEQRRERDAKALQE 45 >ref|XP_007049759.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508702020|gb|EOX93916.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 71 Score = 72.0 bits (175), Expect = 2e-10 Identities = 37/43 (86%), Positives = 39/43 (90%), Gaps = 1/43 (2%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKT-KDDGLTPEQRRERDAKALQE 312 RGNQRERDRERA AR G+K K+ KDDGLTPEQRRERDAKALQE Sbjct: 3 RGNQRERDRERAQARTGNKGKSVKDDGLTPEQRRERDAKALQE 45 >gb|EXC25119.1| hypothetical protein L484_003043 [Morus notabilis] Length = 238 Score = 71.6 bits (174), Expect = 2e-10 Identities = 38/51 (74%), Positives = 40/51 (78%), Gaps = 1/51 (1%) Frame = +1 Query: 163 AYKXXXXXRGNQRERDRERAMARGGSKPK-TKDDGLTPEQRRERDAKALQE 312 A K RGNQRERDRERA AR G K K +K+DGLTPEQRRERDAKALQE Sbjct: 132 ALKPSISERGNQRERDRERAQARAGHKSKHSKNDGLTPEQRRERDAKALQE 182 >ref|XP_006414978.1| hypothetical protein EUTSA_v10026728mg [Eutrema salsugineum] gi|557116148|gb|ESQ56431.1| hypothetical protein EUTSA_v10026728mg [Eutrema salsugineum] Length = 72 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/43 (83%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKT-KDDGLTPEQRRERDAKALQE 312 RGNQRERDRERA ARG KPK K+DGLTPEQRRERDA+ALQE Sbjct: 3 RGNQRERDRERAQARGNHKPKQPKNDGLTPEQRRERDARALQE 45 >ref|XP_006375240.1| hypothetical protein POPTR_0014s05560g [Populus trichocarpa] gi|550323559|gb|ERP53037.1| hypothetical protein POPTR_0014s05560g [Populus trichocarpa] Length = 71 Score = 71.2 bits (173), Expect = 3e-10 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPK-TKDDGLTPEQRRERDAKALQE 312 RGNQRERDRERA AR G K K +KDDGLTPEQRRERDAKALQE Sbjct: 3 RGNQRERDRERAQARVGHKTKNSKDDGLTPEQRRERDAKALQE 45 >ref|XP_007140621.1| hypothetical protein PHAVU_008G127600g [Phaseolus vulgaris] gi|561013754|gb|ESW12615.1| hypothetical protein PHAVU_008G127600g [Phaseolus vulgaris] Length = 107 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKTKDDGLTPEQRRERDAKALQE 312 RGNQR+RDRERA +R G+K K K DGLTPEQRRERDAKALQE Sbjct: 46 RGNQRDRDRERAQSRTGAKGKQKGDGLTPEQRRERDAKALQE 87 >ref|XP_004242406.1| PREDICTED: putative SERF-like protein-like [Solanum lycopersicum] Length = 71 Score = 70.9 bits (172), Expect = 3e-10 Identities = 36/43 (83%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +1 Query: 187 RGNQRERDRERAMARGGSKPKT-KDDGLTPEQRRERDAKALQE 312 RGNQR+RDRERA ARG K KT K+DGLTPEQRRERDAKALQE Sbjct: 3 RGNQRDRDRERAQARGNHKSKTPKNDGLTPEQRRERDAKALQE 45