BLASTX nr result
ID: Akebia23_contig00002799
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00002799 (2490 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37829.1| hypothetical protein MIMGU_mgv1a003764mg [Mimulus... 60 6e-06 >gb|EYU37829.1| hypothetical protein MIMGU_mgv1a003764mg [Mimulus guttatus] Length = 565 Score = 59.7 bits (143), Expect = 6e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +2 Query: 2396 QVDRRYRQYSHQMQIVVSSFDVIAGGGAAKP 2488 +VDRRYRQY HQMQIVVSSFDVIAG GAAKP Sbjct: 228 EVDRRYRQYYHQMQIVVSSFDVIAGAGAAKP 258