BLASTX nr result
ID: Akebia23_contig00001944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00001944 (379 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS74535.1| hypothetical protein M569_00252, partial [Genlise... 69 7e-10 ref|XP_006849011.1| hypothetical protein AMTR_s00028p00129770 [A... 56 6e-06 >gb|EPS74535.1| hypothetical protein M569_00252, partial [Genlisea aurea] Length = 106 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/56 (60%), Positives = 39/56 (69%), Gaps = 4/56 (7%) Frame = -3 Query: 350 DQVGPCNRIDTQCPFNL*VQCD----KGRKIHRATPSSPPCRNYEITPRMPLASRG 195 DQVGPC ++D PFN ++ KGRKIH TPSSPP RNYEITPR P A+RG Sbjct: 26 DQVGPCEQLDALSPFNPLIEMRQNKRKGRKIHGPTPSSPPRRNYEITPRAPSAARG 81 >ref|XP_006849011.1| hypothetical protein AMTR_s00028p00129770 [Amborella trichopoda] gi|548852484|gb|ERN10592.1| hypothetical protein AMTR_s00028p00129770 [Amborella trichopoda] Length = 134 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/52 (55%), Positives = 32/52 (61%), Gaps = 1/52 (1%) Frame = -3 Query: 350 DQVGPCNRIDTQCPFN-L*VQCDKGRKIHRATPSSPPCRNYEITPRMPLASR 198 DQVGPC ++D PF KGRKI TPSSPP RNY+IT RMP R Sbjct: 73 DQVGPCEQLDALSPFKPFERNVAKGRKIRGPTPSSPPHRNYQITSRMPSTFR 124