BLASTX nr result
ID: Akebia23_contig00000498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia23_contig00000498 (462 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC34675.1| Mitochondrial substrate carrier family protein uc... 59 9e-07 >gb|EXC34675.1| Mitochondrial substrate carrier family protein ucpB [Morus notabilis] Length = 1264 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 460 GFSIFARLSPQTTITFLVCEKLRELAGLKAI 368 GF+IFARL PQTTITF++CEKLRELAGLKAI Sbjct: 1234 GFTIFARLGPQTTITFILCEKLRELAGLKAI 1264