BLASTX nr result
ID: Akebia22_contig00057117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00057117 (347 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein... 59 7e-07 ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily p... 59 7e-07 >ref|XP_007041365.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] gi|508705300|gb|EOX97196.1| Pentatricopeptide repeat superfamily protein isoform 6 [Theobroma cacao] Length = 494 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/110 (30%), Positives = 55/110 (50%) Frame = +1 Query: 10 NKIKIHKAFDLETFKQIKLKDLYSINQGQCSSTFDFSSISHTEAPPVHNKDTTESLLEKS 189 N +K HK + K+ KLK + + CSST S + ++ + + LL +S Sbjct: 14 NNMKAHKVLSSQILKRKKLKTVIPHSSALCSST---SQLVTSDQSQTASSQISPELLIES 70 Query: 190 ILESNWNSIQDIYPTLSPYLIQNVLVKLHKSPNVILGFIEELGFVRFDLK 339 + S W+ I+ L+P +I VL+ LHK+P + L F + F R D+K Sbjct: 71 VRSSQWHFIKHQSSDLNPSVISTVLLNLHKTPELALQFTSHIEFQRLDVK 120 >ref|XP_007041360.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682507|ref|XP_007041361.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682510|ref|XP_007041362.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682513|ref|XP_007041363.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682516|ref|XP_007041364.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590682524|ref|XP_007041366.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705295|gb|EOX97191.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705296|gb|EOX97192.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705297|gb|EOX97193.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705298|gb|EOX97194.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705299|gb|EOX97195.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508705301|gb|EOX97197.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 650 Score = 58.9 bits (141), Expect = 7e-07 Identities = 34/110 (30%), Positives = 55/110 (50%) Frame = +1 Query: 10 NKIKIHKAFDLETFKQIKLKDLYSINQGQCSSTFDFSSISHTEAPPVHNKDTTESLLEKS 189 N +K HK + K+ KLK + + CSST S + ++ + + LL +S Sbjct: 14 NNMKAHKVLSSQILKRKKLKTVIPHSSALCSST---SQLVTSDQSQTASSQISPELLIES 70 Query: 190 ILESNWNSIQDIYPTLSPYLIQNVLVKLHKSPNVILGFIEELGFVRFDLK 339 + S W+ I+ L+P +I VL+ LHK+P + L F + F R D+K Sbjct: 71 VRSSQWHFIKHQSSDLNPSVISTVLLNLHKTPELALQFTSHIEFQRLDVK 120