BLASTX nr result
ID: Akebia22_contig00055956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00055956 (244 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI30094.3| unnamed protein product [Vitis vinifera] 80 2e-13 ref|XP_003632690.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 ref|XP_007204422.1| hypothetical protein PRUPE_ppb002215mg [Prun... 72 8e-11 gb|EXB41187.1| hypothetical protein L484_005223 [Morus notabilis] 70 2e-10 ref|XP_004498123.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 68 1e-09 ref|XP_006340092.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_004237347.1| PREDICTED: pentatricopeptide repeat-containi... 66 4e-09 ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 gb|ABL85030.1| hypothetical protein 57h21.3 [Brachypodium sylvat... 64 2e-08 ref|XP_006587960.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 emb|CBI38165.3| unnamed protein product [Vitis vinifera] 64 3e-08 ref|XP_002264325.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_007161435.1| hypothetical protein PHAVU_001G068400g [Phas... 63 4e-08 ref|XP_006439810.1| hypothetical protein CICLE_v10018848mg [Citr... 63 4e-08 ref|XP_006827212.1| hypothetical protein AMTR_s00010p00259620 [A... 63 4e-08 ref|XP_002302000.2| pentatricopeptide repeat-containing family p... 63 5e-08 ref|XP_002305733.2| hypothetical protein POPTR_0004s05810g, part... 62 6e-08 ref|XP_006857329.1| hypothetical protein AMTR_s00067p00084250 [A... 62 6e-08 ref|XP_004966624.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 >emb|CBI30094.3| unnamed protein product [Vitis vinifera] Length = 614 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDY 150 PGCSWIE NRVH+F+VGD+SHSQ+KLI SLL+DLH KMK+ GY P D+ Sbjct: 556 PGCSWIEVGNRVHVFVVGDKSHSQSKLIYSLLRDLHSKMKKAGYEPNNDF 605 >ref|XP_003632690.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like [Vitis vinifera] Length = 635 Score = 80.5 bits (197), Expect = 2e-13 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDY 150 PGCSWIE NRVH+F+VGD+SHSQ+KLI SLL+DLH KMK+ GY P D+ Sbjct: 577 PGCSWIEVGNRVHVFVVGDKSHSQSKLIYSLLRDLHSKMKKAGYEPNNDF 626 >ref|XP_007204422.1| hypothetical protein PRUPE_ppb002215mg [Prunus persica] gi|462399953|gb|EMJ05621.1| hypothetical protein PRUPE_ppb002215mg [Prunus persica] Length = 634 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/49 (59%), Positives = 41/49 (83%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKD 147 PGCSWIE N+VH+F+VGD+SH Q++LI SL+ +LH +MK++GY+P D Sbjct: 578 PGCSWIEVGNKVHVFVVGDKSHYQSELIYSLIYNLHERMKKIGYIPYDD 626 >gb|EXB41187.1| hypothetical protein L484_005223 [Morus notabilis] Length = 622 Score = 70.5 bits (171), Expect = 2e-10 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKD 147 PGCSWIE N VH+F+VGDESH+Q+ LI SL+ DLH KMK++GY+ + Sbjct: 567 PGCSWIEVGNMVHVFVVGDESHTQSGLIYSLVCDLHEKMKKIGYISNNE 615 >ref|XP_004498123.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like [Cicer arietinum] Length = 665 Score = 68.2 bits (165), Expect = 1e-09 Identities = 29/55 (52%), Positives = 41/55 (74%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDYKMALE 165 PGCSWIE N V +F+VGD+SHSQ++++ LL DLH KMK+ G +P+ D + +E Sbjct: 574 PGCSWIEVGNTVQVFVVGDKSHSQSEMLGYLLLDLHTKMKKAGDIPEDDLLVDVE 628 >ref|XP_006340092.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like [Solanum tuberosum] Length = 641 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKD 147 PGCSWI ENRVH+F+VGD SH + ++I SLL +LH+KMKR G P D Sbjct: 577 PGCSWIAVENRVHVFLVGDTSHYETEVIHSLLGNLHMKMKRTGCPPVDD 625 >ref|XP_004237347.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like [Solanum lycopersicum] Length = 624 Score = 66.2 bits (160), Expect = 4e-09 Identities = 28/48 (58%), Positives = 37/48 (77%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQK 144 PGCSWI ENRVH+F+VGD SH + ++I SLL +LH+KMKR G + + Sbjct: 577 PGCSWIAVENRVHVFLVGDTSHCETEVIHSLLGNLHMKMKRTGLLTNR 624 >ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Solanum tuberosum] Length = 804 Score = 65.1 bits (157), Expect = 1e-08 Identities = 24/50 (48%), Positives = 39/50 (78%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDY 150 PGCSWI+ EN VH+F+VGD +H + +++ + L++L +KM+++GYVP Y Sbjct: 670 PGCSWIKVENTVHVFLVGDTAHPEIQVVYNYLEELRLKMRKMGYVPDTQY 719 >gb|ABL85030.1| hypothetical protein 57h21.3 [Brachypodium sylvaticum] Length = 618 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/52 (53%), Positives = 40/52 (76%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDYKM 156 PGCSWIE EN+VH+F+ D+SHS++ LI+SLLQD+H M+ VP+ D ++ Sbjct: 557 PGCSWIEVENKVHVFVSRDKSHSESDLINSLLQDIHDIMRMACTVPRDDMQL 608 >ref|XP_006587960.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like isoform X2 [Glycine max] gi|571479769|ref|XP_006587961.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like isoform X3 [Glycine max] gi|571479771|ref|XP_003533693.2| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like isoform X1 [Glycine max] Length = 618 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/55 (50%), Positives = 38/55 (69%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDYKMALE 165 PGCSWIE N V +F+VGD+ HSQ + + LL DLH KMK+ G +P D +++E Sbjct: 563 PGCSWIEVGNTVQVFVVGDKPHSQYEPLGHLLHDLHTKMKKAGDMPDDDLLVSVE 617 >ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Solanum lycopersicum] Length = 804 Score = 63.5 bits (153), Expect = 3e-08 Identities = 23/50 (46%), Positives = 39/50 (78%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDY 150 PGCSWI+ EN VH+F+VGD +H + +++ + L++L +KM+++G+VP Y Sbjct: 670 PGCSWIKVENTVHVFLVGDTAHPEIQVVYNYLEELRLKMRKMGFVPDTQY 719 >emb|CBI38165.3| unnamed protein product [Vitis vinifera] Length = 654 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/56 (53%), Positives = 40/56 (71%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDYKMALEE 168 PGCSWIE E+RVH+F+V D+SH K I S+L+ L +MKRVGY+P + A +E Sbjct: 594 PGCSWIEVESRVHVFLVKDKSHPHRKQIYSVLKMLTEQMKRVGYIPDANDFEAYDE 649 >ref|XP_002264325.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600 [Vitis vinifera] Length = 684 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/56 (53%), Positives = 40/56 (71%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDYKMALEE 168 PGCSWIE E+RVH+F+V D+SH K I S+L+ L +MKRVGY+P + A +E Sbjct: 624 PGCSWIEVESRVHVFLVKDKSHPHRKQIYSVLKMLTEQMKRVGYIPDANDFEAYDE 679 >ref|XP_007161435.1| hypothetical protein PHAVU_001G068400g [Phaseolus vulgaris] gi|561034899|gb|ESW33429.1| hypothetical protein PHAVU_001G068400g [Phaseolus vulgaris] Length = 616 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDYKMALE 165 PGCSWIE N V +F+VGD+SHSQ +L+ LL D+H KMK+ P D + +E Sbjct: 560 PGCSWIEVGNTVQVFVVGDKSHSQYELLGHLLDDIHTKMKKAMDTPHNDLLINVE 614 >ref|XP_006439810.1| hypothetical protein CICLE_v10018848mg [Citrus clementina] gi|557542072|gb|ESR53050.1| hypothetical protein CICLE_v10018848mg [Citrus clementina] Length = 841 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/56 (50%), Positives = 38/56 (67%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDYKMALEE 168 PGCSWIE N +HIF+ GD SH Q+ I S +++L ++MKR GY+PQ + EE Sbjct: 772 PGCSWIEVNNNIHIFIAGDHSHHQSDEIYSAIENLTLEMKREGYIPQLQSVVIPEE 827 >ref|XP_006827212.1| hypothetical protein AMTR_s00010p00259620 [Amborella trichopoda] gi|548831641|gb|ERM94449.1| hypothetical protein AMTR_s00010p00259620 [Amborella trichopoda] Length = 330 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/46 (60%), Positives = 37/46 (80%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVP 138 PGCSWIE +NRV++F+VGD+SH +A+ I SLL+ L+ M R GYVP Sbjct: 279 PGCSWIEVKNRVNVFVVGDKSHEKAERIYSLLKGLYRHMMRAGYVP 324 >ref|XP_002302000.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344162|gb|EEE81273.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 797 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/50 (50%), Positives = 37/50 (74%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDY 150 PGCSWIE EN+VH F+VGD +H + + I + L+ L ++M+++GYVP Y Sbjct: 663 PGCSWIEVENKVHSFLVGDANHPEVRQIYNYLEQLVLEMRKIGYVPDTKY 712 >ref|XP_002305733.2| hypothetical protein POPTR_0004s05810g, partial [Populus trichocarpa] gi|550340410|gb|EEE86244.2| hypothetical protein POPTR_0004s05810g, partial [Populus trichocarpa] Length = 778 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVPQKDYKM 156 PGCSWIE +++VHIF+ G+ SH QAK I LL+ L KMK GY P+ Y + Sbjct: 644 PGCSWIEVKSKVHIFLAGNSSHPQAKKIEVLLKRLRSKMKEEGYFPKTRYAL 695 >ref|XP_006857329.1| hypothetical protein AMTR_s00067p00084250 [Amborella trichopoda] gi|548861422|gb|ERN18796.1| hypothetical protein AMTR_s00067p00084250 [Amborella trichopoda] Length = 630 Score = 62.4 bits (150), Expect = 6e-08 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVP 138 PGCSWIEG+ R+HIF VGD+SH Q K I L+ L +++K+ GY P Sbjct: 576 PGCSWIEGDERMHIFFVGDKSHPQYKTIHECLKSLMLQIKKAGYSP 621 >ref|XP_004966624.1| PREDICTED: pentatricopeptide repeat-containing protein At2g35030, mitochondrial-like [Setaria italica] Length = 618 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/46 (58%), Positives = 37/46 (80%) Frame = +1 Query: 1 PGCSWIEGENRVHIFMVGDESHSQAKLISSLLQDLHVKMKRVGYVP 138 PGCSWIE N+VHIF+ D+SHS+++LI+ L+QD+H M+ VG VP Sbjct: 562 PGCSWIEVANKVHIFVSRDKSHSESELINGLVQDIHHMMRIVGTVP 607