BLASTX nr result
ID: Akebia22_contig00055903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00055903 (223 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006826399.1| hypothetical protein AMTR_s00004p00149230 [A... 85 1e-14 ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_003606846.1| Pentatricopeptide repeat-containing protein ... 67 3e-09 ref|XP_004507375.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_006854103.1| hypothetical protein AMTR_s00048p00141020 [A... 65 1e-08 ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006341056.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004171797.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_006849567.1| hypothetical protein AMTR_s00024p00183850 [A... 62 8e-08 ref|XP_004246460.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 gb|EPS62139.1| hypothetical protein M569_12655 [Genlisea aurea] 61 1e-07 ref|XP_007161634.1| hypothetical protein PHAVU_001G085800g [Phas... 61 2e-07 ref|XP_006376536.1| hypothetical protein POPTR_0013s14620g, part... 61 2e-07 ref|XP_002444001.1| hypothetical protein SORBIDRAFT_07g005650 [S... 61 2e-07 ref|XP_007144456.1| hypothetical protein PHAVU_007G157700g [Phas... 60 2e-07 ref|XP_002317023.2| hypothetical protein POPTR_0011s14750g [Popu... 60 2e-07 ref|XP_002456972.1| hypothetical protein SORBIDRAFT_03g046570 [S... 60 2e-07 gb|EYU35942.1| hypothetical protein MIMGU_mgv1a002651mg [Mimulus... 60 3e-07 ref|XP_006344105.1| PREDICTED: putative pentatricopeptide repeat... 60 3e-07 >ref|XP_006826399.1| hypothetical protein AMTR_s00004p00149230 [Amborella trichopoda] gi|548830713|gb|ERM93636.1| hypothetical protein AMTR_s00004p00149230 [Amborella trichopoda] Length = 648 Score = 84.7 bits (208), Expect = 1e-14 Identities = 34/74 (45%), Positives = 54/74 (72%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 +FNI+M+ C +G+ EA E F M+++D+ PDL+++N LI G+C G+ E +C L KQM Sbjct: 209 SFNIIMREYCKDGKFAEAIELFHLMREKDYTPDLNTYNTLIHGYCKVGEGERVCELVKQM 268 Query: 43 LDQNVKPDSYTINL 2 LD ++PDSYT+++ Sbjct: 269 LDMRIRPDSYTMSI 282 >ref|XP_004230838.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Solanum lycopersicum] Length = 618 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/73 (42%), Positives = 47/73 (64%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 TFNI++ V C EG+ ++A EF M+ P+L SFN +I G+C++GD E +F+ M Sbjct: 212 TFNIMINVLCREGKLKKAKEFIEHMQCSGVKPNLISFNTVIHGYCLRGDIEGANKIFEAM 271 Query: 43 LDQNVKPDSYTIN 5 + ++PDSYT N Sbjct: 272 TAKGIEPDSYTFN 284 >ref|XP_003606846.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355507901|gb|AES89043.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 624 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/73 (38%), Positives = 47/73 (64%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 TFNI++ + C EG+ ++A +F M+ P++ ++N +I G+C++G E +FK M Sbjct: 219 TFNIMINILCREGKWKKAKDFIGHMEVYGVKPNVVTYNTVINGYCLRGKFEAASKIFKTM 278 Query: 43 LDQNVKPDSYTIN 5 D+N+KPD YT N Sbjct: 279 KDKNLKPDCYTYN 291 >ref|XP_004507375.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Cicer arietinum] Length = 666 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/73 (39%), Positives = 48/73 (65%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 TFNI++ V C EG+ ++A EF M+ P++ ++N LI G+C++G E ++F++M Sbjct: 261 TFNIMINVLCKEGKLKKAKEFIVYMEAFGVKPNIVTYNTLIHGYCLRGKFERAHAIFQKM 320 Query: 43 LDQNVKPDSYTIN 5 D+ +KPD YT N Sbjct: 321 KDKGLKPDCYTYN 333 >ref|XP_006346504.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15630, mitochondrial-like [Solanum tuberosum] Length = 618 Score = 64.7 bits (156), Expect = 1e-08 Identities = 29/73 (39%), Positives = 46/73 (63%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 TFNI++ V C EG+ ++A EF M+ P+L S+N +I G+C++GD E + + M Sbjct: 212 TFNIMINVLCREGKLKKAKEFIEHMQCSGVKPNLISYNTVIHGYCLRGDIEGANKILETM 271 Query: 43 LDQNVKPDSYTIN 5 + ++PDSYT N Sbjct: 272 TAKGIEPDSYTFN 284 >ref|XP_006854103.1| hypothetical protein AMTR_s00048p00141020 [Amborella trichopoda] gi|548857772|gb|ERN15570.1| hypothetical protein AMTR_s00048p00141020 [Amborella trichopoda] Length = 609 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/73 (41%), Positives = 41/73 (56%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 T+N ++ C EGR +A + F M +R VPD +F LI G+C G E LF +M Sbjct: 329 TYNTILNGLCKEGRLSDADDLFKEMAERGLVPDYVTFTTLIDGYCRDGSIEKAQDLFDEM 388 Query: 43 LDQNVKPDSYTIN 5 D+N+KPD T N Sbjct: 389 RDRNLKPDIVTYN 401 >ref|XP_004167184.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 605 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/74 (40%), Positives = 43/74 (58%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 T+NI++ C GR +EA + F MK + +P + S+N LI GFC G E L +M Sbjct: 217 TYNIIVDGLCKVGREDEAKQLFEEMKTQGMIPSIISYNSLIHGFCCAGKWEESKRLLDEM 276 Query: 43 LDQNVKPDSYTINL 2 LDQ ++PD T N+ Sbjct: 277 LDQGLQPDMVTFNV 290 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/74 (36%), Positives = 41/74 (55%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 TFN+++ C EG+ EA + M + VPDL ++N LI+GFC+ GD LF M Sbjct: 287 TFNVLIDTLCKEGKVIEAKKLLGVMIESGIVPDLVTYNSLIEGFCMVGDLNSARELFVSM 346 Query: 43 LDQNVKPDSYTINL 2 + +PD + N+ Sbjct: 347 PSKGCEPDVISYNV 360 >ref|XP_006341056.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Solanum tuberosum] Length = 766 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/74 (33%), Positives = 45/74 (60%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 T+N ++ C E + +EA+EF + + F+PD+ +FN LI+G C G + +F++M Sbjct: 381 TYNTIISALCKENQVQEATEFARVLTSKGFLPDVCTFNSLIQGLCFTGSFNVAMEMFEEM 440 Query: 43 LDQNVKPDSYTINL 2 D+ +PD +T N+ Sbjct: 441 KDKGCQPDEFTYNI 454 >ref|XP_004171797.1| PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cucumis sativus] Length = 618 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/74 (39%), Positives = 45/74 (60%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 T++I++ C GR +EA E F MK + +PD+ S++ LI GFC G + LF +M Sbjct: 239 TYSIIIDGLCKVGREDEAKELFEEMKAQGMIPDVISYSTLIHGFCCAGKWDQSKHLFDEM 298 Query: 43 LDQNVKPDSYTINL 2 +DQ V+PD T ++ Sbjct: 299 VDQGVQPDMVTFSV 312 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 TF++++ C EG+ EA + M +R VP+L ++N LI GFC+ GD LF M Sbjct: 309 TFSVLIDTLCKEGKVTEAKKLLEVMIQRGIVPNLITYNSLIDGFCMVGDLNSARELFLSM 368 Query: 43 LDQNVKPD--SYT 11 + ++PD SYT Sbjct: 369 PSKGLEPDEISYT 381 >ref|XP_006849567.1| hypothetical protein AMTR_s00024p00183850 [Amborella trichopoda] gi|548853142|gb|ERN11148.1| hypothetical protein AMTR_s00024p00183850 [Amborella trichopoda] Length = 633 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/71 (36%), Positives = 44/71 (61%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 TFNI++ + C EG+ +A EF S M+ F P + ++N ++ G+C KG ++ +F M Sbjct: 231 TFNIMINILCKEGKLNKAKEFLSYMEGLGFKPTVVTYNTVLNGYCNKGKVQIALEIFDTM 290 Query: 43 LDQNVKPDSYT 11 ++ V PDS+T Sbjct: 291 KNRGVSPDSFT 301 >ref|XP_004246460.1| PREDICTED: pentatricopeptide repeat-containing protein At3g53700, chloroplastic-like [Solanum lycopersicum] Length = 766 Score = 61.6 bits (148), Expect = 1e-07 Identities = 24/74 (32%), Positives = 45/74 (60%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 T+N ++ C + +EA+EF + + F+PD+ +FN LI+G C G+ + +F++M Sbjct: 381 TYNTIISALCKVNQVQEATEFARVLTSKGFLPDVCTFNSLIQGLCFTGNFNIAMEMFEEM 440 Query: 43 LDQNVKPDSYTINL 2 D+ +PD +T N+ Sbjct: 441 KDKGCQPDEFTYNI 454 >gb|EPS62139.1| hypothetical protein M569_12655 [Genlisea aurea] Length = 596 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/70 (35%), Positives = 44/70 (62%) Frame = -1 Query: 220 FNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQML 41 ++I++K C GR ++A + M++R VPD+ +N+L++GFC D + + ++M Sbjct: 489 YSILVKGLCRYGRLDDADRMVTEMEERGIVPDVVMYNVLMRGFCDSNDAGKVVEILRRMA 548 Query: 40 DQNVKPDSYT 11 D+ V PDSYT Sbjct: 549 DRRVAPDSYT 558 >ref|XP_007161634.1| hypothetical protein PHAVU_001G085800g [Phaseolus vulgaris] gi|561035098|gb|ESW33628.1| hypothetical protein PHAVU_001G085800g [Phaseolus vulgaris] Length = 618 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/73 (36%), Positives = 46/73 (63%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 TFNI++ V C EG+ ++A+EF M+ P++ ++N +I G CV+G + +F+ M Sbjct: 213 TFNIMVNVLCKEGKLKKANEFIGHMEALGVKPNVVTYNTVIHGHCVRGKFQRARVIFQTM 272 Query: 43 LDQNVKPDSYTIN 5 D+ ++PD YT N Sbjct: 273 KDKGLEPDCYTYN 285 >ref|XP_006376536.1| hypothetical protein POPTR_0013s14620g, partial [Populus trichocarpa] gi|550325854|gb|ERP54333.1| hypothetical protein POPTR_0013s14620g, partial [Populus trichocarpa] Length = 557 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/73 (38%), Positives = 42/73 (57%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 TF+ ++ C+EGR A EFF+ M R + P+L ++N +I G C GDT + L K+M Sbjct: 134 TFSTLVNGLCIEGRIARAVEFFNDMVARGYEPNLHTYNTIINGLCKIGDTSVAAGLLKKM 193 Query: 43 LDQNVKPDSYTIN 5 + +PD T N Sbjct: 194 DEAGCEPDVVTYN 206 >ref|XP_002444001.1| hypothetical protein SORBIDRAFT_07g005650 [Sorghum bicolor] gi|241940351|gb|EES13496.1| hypothetical protein SORBIDRAFT_07g005650 [Sorghum bicolor] Length = 824 Score = 60.8 bits (146), Expect = 2e-07 Identities = 29/73 (39%), Positives = 40/73 (54%) Frame = -1 Query: 220 FNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQML 41 +NI M C G EA + + M VPD + LI G+C+KG+TE +F+QML Sbjct: 407 YNITMDAYCKLGNMNEAVKLLNEMMAGGLVPDKIHYTCLINGYCLKGETENAWQVFEQML 466 Query: 40 DQNVKPDSYTINL 2 N+KPD T N+ Sbjct: 467 KANIKPDVVTYNI 479 >ref|XP_007144456.1| hypothetical protein PHAVU_007G157700g [Phaseolus vulgaris] gi|561017646|gb|ESW16450.1| hypothetical protein PHAVU_007G157700g [Phaseolus vulgaris] Length = 755 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/74 (33%), Positives = 44/74 (59%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 TFN ++ C E E A+E + + F+PD+ +FN LI+G C+ + E+ LF++M Sbjct: 373 TFNTLISTLCKENHVEAATELARVLTSKGFLPDVCTFNSLIQGLCLTSNREIAMELFEEM 432 Query: 43 LDQNVKPDSYTINL 2 D+ +PD +T ++ Sbjct: 433 KDKGCEPDEFTYSI 446 >ref|XP_002317023.2| hypothetical protein POPTR_0011s14750g [Populus trichocarpa] gi|550328410|gb|EEE97635.2| hypothetical protein POPTR_0011s14750g [Populus trichocarpa] Length = 567 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/74 (36%), Positives = 48/74 (64%), Gaps = 2/74 (2%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 T++ +++ C+EG +EA E F +++ D+ P LD+FN LI GFC G T++ +F+ M Sbjct: 448 TYSSLIRGLCIEGMLDEALEIFRLLEENDYRPILDNFNALILGFCKSGRTDLSLDIFEMM 507 Query: 43 LDQNVKPD--SYTI 8 +++ P+ +YTI Sbjct: 508 VEKGYTPNETTYTI 521 >ref|XP_002456972.1| hypothetical protein SORBIDRAFT_03g046570 [Sorghum bicolor] gi|241928947|gb|EES02092.1| hypothetical protein SORBIDRAFT_03g046570 [Sorghum bicolor] Length = 821 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/73 (38%), Positives = 40/73 (54%) Frame = -1 Query: 220 FNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQML 41 +N+ M C G EA + + M VPD + LI G+C+KG+TE +F+QML Sbjct: 407 YNVAMDAYCKLGNMNEAVKLLNEMMAGGLVPDKIHYTCLINGYCLKGETENAWQVFEQML 466 Query: 40 DQNVKPDSYTINL 2 N+KPD T N+ Sbjct: 467 KANIKPDVVTYNI 479 >gb|EYU35942.1| hypothetical protein MIMGU_mgv1a002651mg [Mimulus guttatus] Length = 650 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/73 (38%), Positives = 41/73 (56%) Frame = -1 Query: 223 TFNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQM 44 T+N ++ C E EA F+ M +R PD ++ LI G+C KGD + LF+ M Sbjct: 399 TYNTLLNGLCKEHMLCEADALFNEMVERGVFPDFCTYTTLINGYCKKGDMDRALDLFESM 458 Query: 43 LDQNVKPDSYTIN 5 L +N+KPD+ T N Sbjct: 459 LQRNLKPDAVTYN 471 >ref|XP_006344105.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial-like [Solanum tuberosum] Length = 590 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/73 (34%), Positives = 45/73 (61%) Frame = -1 Query: 220 FNIVMKVACVEGRTEEASEFFSTMKKRDFVPDLDSFNILIKGFCVKGDTEMICSLFKQML 41 ++IV+ C +G + A + MK++D PD+ ++N +I G C G E + SLF +M+ Sbjct: 214 YSIVIDALCKDGNLDAAINILNEMKQKDIPPDIVTYNSIIDGLCKFGQWEKVTSLFYEMV 273 Query: 40 DQNVKPDSYTINL 2 + N+ PD +T+N+ Sbjct: 274 NLNIYPDVHTLNI 286