BLASTX nr result
ID: Akebia22_contig00055901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00055901 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83297.1| hypothetical protein VITISV_008291 [Vitis vinifera] 57 3e-06 >emb|CAN83297.1| hypothetical protein VITISV_008291 [Vitis vinifera] Length = 601 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/79 (36%), Positives = 39/79 (49%) Frame = -1 Query: 238 KSYGWDSPWKLDQMVSLTFY*CWEVINENFMNMLRYFQGEKFLN*GSYCTFLVFIPKKQE 59 K W S K+ + CW+VI E+ M + F +N + TF+ +PKK + Sbjct: 471 KXRSWPSSLKVSSFAPKLYQECWDVIKEDLMRVFLEFHTNGIINQSTNATFIAMVPKKSQ 530 Query: 58 LEDISDLCPISLVCSSYKI 2 ISD PISLV S YKI Sbjct: 531 TFKISDYRPISLVTSLYKI 549