BLASTX nr result
ID: Akebia22_contig00055640
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00055640 (283 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281821.2| PREDICTED: putative pentatricopeptide repeat... 78 1e-12 emb|CAN66662.1| hypothetical protein VITISV_031722 [Vitis vinifera] 78 1e-12 emb|CBI15198.3| unnamed protein product [Vitis vinifera] 73 4e-11 ref|XP_007048433.1| Tetratricopeptide repeat-like superfamily pr... 72 8e-11 ref|XP_006582543.1| PREDICTED: putative pentatricopeptide repeat... 64 3e-08 gb|EXB38563.1| hypothetical protein L484_008591 [Morus notabilis] 62 6e-08 ref|XP_006354595.1| PREDICTED: pentatricopeptide repeat-containi... 62 8e-08 ref|XP_001785902.1| predicted protein [Physcomitrella patens] gi... 62 8e-08 gb|AEB39780.1| pentatricopeptide repeat protein 45 [Funaria hygr... 62 1e-07 ref|XP_002972228.1| hypothetical protein SELMODRAFT_97343 [Selag... 61 1e-07 ref|XP_002984141.1| hypothetical protein SELMODRAFT_119895 [Sela... 61 1e-07 ref|XP_006579270.1| PREDICTED: putative pentatricopeptide repeat... 61 2e-07 ref|XP_007032935.1| Pentatricopeptide repeat (PPR) superfamily p... 60 3e-07 gb|AFW64322.1| hypothetical protein ZEAMMB73_176484 [Zea mays] 60 3e-07 gb|AEU08424.1| pentatricopeptide repeat protein [Physcomitrium p... 60 4e-07 ref|XP_003573036.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_004229576.1| PREDICTED: pentatricopeptide repeat-containi... 59 5e-07 gb|AEP33771.1| organelle transcript processing 82, partial [Thla... 59 5e-07 ref|XP_002454621.1| hypothetical protein SORBIDRAFT_04g034420 [S... 59 7e-07 gb|AEB39778.1| pentatricopeptide repeat protein 77 [Funaria hygr... 59 9e-07 >ref|XP_002281821.2| PREDICTED: putative pentatricopeptide repeat-containing protein At1g74400-like [Vitis vinifera] Length = 482 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/63 (60%), Positives = 45/63 (71%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHRRSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSMIKN 102 YAA GMWD+KM+VR QIK RR PG SSIEV I EFVAAD +HP +IYE+L + + Sbjct: 408 YAAKGMWDKKMLVRNQIKQRRDPGCSSIEVGIDIKEFVAADDQHPCMPQIYEILDHLTRT 467 Query: 101 MEA 93 M A Sbjct: 468 MRA 470 >emb|CAN66662.1| hypothetical protein VITISV_031722 [Vitis vinifera] Length = 1060 Score = 78.2 bits (191), Expect = 1e-12 Identities = 38/63 (60%), Positives = 45/63 (71%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHRRSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSMIKN 102 YAA GMWD+KM+VR QIK RR PG SSIEV I EFVAAD +HP +IYE+L + + Sbjct: 986 YAAKGMWDKKMLVRNQIKQRRDPGCSSIEVGIDIKEFVAADDQHPCMPQIYEILDHLTRT 1045 Query: 101 MEA 93 M A Sbjct: 1046 MRA 1048 >emb|CBI15198.3| unnamed protein product [Vitis vinifera] Length = 948 Score = 73.2 bits (178), Expect = 4e-11 Identities = 35/59 (59%), Positives = 42/59 (71%) Frame = -3 Query: 269 GMWDEKMIVRAQIKHRRSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSMIKNMEA 93 GMWD+KM+VR QIK RR PG SSIEV I EFVAAD +HP +IYE+L + + M A Sbjct: 878 GMWDKKMLVRNQIKQRRDPGCSSIEVGIDIKEFVAADDQHPCMPQIYEILDHLTRTMRA 936 >ref|XP_007048433.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] gi|508700694|gb|EOX92590.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 477 Score = 72.0 bits (175), Expect = 8e-11 Identities = 37/67 (55%), Positives = 46/67 (68%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHRRSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSMIKN 102 YAA GMWD+K+ VR QI RR+PG SSIEV S I EFV+AD HPL EI E L + + Sbjct: 402 YAAKGMWDKKVTVRDQITQRRAPGCSSIEVASEISEFVSADDDHPLTAEICEALNYLTVS 461 Query: 101 MEAYSSS 81 ++A+ S Sbjct: 462 IKAHGYS 468 >ref|XP_006582543.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g74400-like [Glycine max] Length = 448 Score = 63.5 bits (153), Expect = 3e-08 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHRRSPGSSSIEVESGIHEFVAADKKHPLKREI 132 YA GMW+ K++VR QIKH R+PG SSIEV SG EFV +D HPL ++ Sbjct: 399 YANKGMWNNKIVVRNQIKHSRAPGCSSIEVGSGAGEFVTSDDDHPLMTDV 448 >gb|EXB38563.1| hypothetical protein L484_008591 [Morus notabilis] Length = 451 Score = 62.4 bits (150), Expect = 6e-08 Identities = 32/46 (69%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQI-KHRRSPGSSSIEVESGIHEFVAADKKHP 147 YAA GMW+ KM VR Q+ K RRSPG SSIEV SGI EFVA+D HP Sbjct: 406 YAAEGMWERKMTVRDQMTKQRRSPGCSSIEVGSGISEFVASDDNHP 451 >ref|XP_006354595.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X1 [Solanum tuberosum] gi|565376192|ref|XP_006354596.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X2 [Solanum tuberosum] gi|565376194|ref|XP_006354597.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X3 [Solanum tuberosum] gi|565376199|ref|XP_006354598.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X4 [Solanum tuberosum] gi|565376201|ref|XP_006354599.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X5 [Solanum tuberosum] gi|565376203|ref|XP_006354600.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like isoform X6 [Solanum tuberosum] Length = 624 Score = 62.0 bits (149), Expect = 8e-08 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 3/70 (4%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHR---RSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YAA G WD VRA +K + PG SSIEV + +HEF+A D KHP +EIY +L M Sbjct: 465 YAAAGDWDGVAKVRALMKRSGVDKEPGCSSIEVNNKVHEFLAGDMKHPKSKEIYIMLEEM 524 Query: 110 IKNMEAYSSS 81 K +EA+ S Sbjct: 525 NKWLEAHGYS 534 >ref|XP_001785902.1| predicted protein [Physcomitrella patens] gi|162662428|gb|EDQ49285.1| predicted protein [Physcomitrella patens] Length = 908 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/66 (43%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHR---RSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YAA G W++K++VR+ ++ R + PG S IEV++ IH FV D HP +EIY L + Sbjct: 749 YAATGNWEQKLLVRSMMQRRGIRKEPGRSWIEVDNQIHSFVVGDTSHPESKEIYAKLKDL 808 Query: 110 IKNMEA 93 IK ++A Sbjct: 809 IKRLKA 814 >gb|AEB39780.1| pentatricopeptide repeat protein 45 [Funaria hygrometrica] Length = 1097 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 3/66 (4%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKH---RRSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YAA G W++K++VR+ ++ R+ PG S IEV++ IH FV D HP +EIY L + Sbjct: 938 YAATGKWEQKLLVRSMMQRKGIRKEPGRSWIEVDNRIHSFVVGDTSHPESKEIYAQLNDL 997 Query: 110 IKNMEA 93 I+ ++A Sbjct: 998 IERLKA 1003 >ref|XP_002972228.1| hypothetical protein SELMODRAFT_97343 [Selaginella moellendorffii] gi|300159695|gb|EFJ26314.1| hypothetical protein SELMODRAFT_97343 [Selaginella moellendorffii] Length = 487 Score = 61.2 bits (147), Expect = 1e-07 Identities = 36/88 (40%), Positives = 48/88 (54%), Gaps = 7/88 (7%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKH---RRSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YAA G WD+ VR+ +K ++ PG SSIEV S +HEF A DK HP EIY +L S+ Sbjct: 328 YAAAGEWDQVDRVRSAMKAMGLQKDPGRSSIEVNSRVHEFWAGDKSHPRAAEIYGLLESL 387 Query: 110 IKNMEAYSSSADG----FNIED*MNERI 39 + ME D N+ + ER+ Sbjct: 388 TRQMEGSGYVPDTKLVLLNVSEEQKERL 415 >ref|XP_002984141.1| hypothetical protein SELMODRAFT_119895 [Selaginella moellendorffii] gi|300147990|gb|EFJ14651.1| hypothetical protein SELMODRAFT_119895 [Selaginella moellendorffii] Length = 487 Score = 61.2 bits (147), Expect = 1e-07 Identities = 36/88 (40%), Positives = 48/88 (54%), Gaps = 7/88 (7%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKH---RRSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YAA G WD+ VR+ +K ++ PG SSIEV S +HEF A DK HP EIY +L S+ Sbjct: 328 YAAAGEWDQVDRVRSAMKAMGLQKDPGRSSIEVNSRVHEFWAGDKSHPRAAEIYGLLESL 387 Query: 110 IKNMEAYSSSADG----FNIED*MNERI 39 + ME D N+ + ER+ Sbjct: 388 TRQMEGSGYVPDTKLVLLNVSEEQKERL 415 >ref|XP_006579270.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g74400-like [Glycine max] Length = 352 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHRRSPGSSSIEVESGIHEFVAADKKHPL 144 YA GMW++K++V+ QIK R+PG SSIEV SG+ EFV +D HPL Sbjct: 303 YANKGMWNKKIVVKNQIKQSRAPGCSSIEVGSGVSEFVVSDDNHPL 348 >ref|XP_007032935.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508711964|gb|EOY03861.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 860 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/78 (38%), Positives = 45/78 (57%), Gaps = 3/78 (3%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKH---RRSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YA GMWD+ +R +++ ++ PG S IEV+ +H F+ DK HP +EIYE LG + Sbjct: 766 YADAGMWDKVSDMRKIMRYNKLKKEPGCSWIEVKDEVHAFLVGDKAHPRCKEIYEKLGIL 825 Query: 110 IKNMEAYSSSADGFNIED 57 + M Y + D F E+ Sbjct: 826 VDEMRCYVADIDFFLEEE 843 >gb|AFW64322.1| hypothetical protein ZEAMMB73_176484 [Zea mays] Length = 496 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/73 (41%), Positives = 43/73 (58%), Gaps = 3/73 (4%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHR---RSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YAAVG WD VR+ +K R + PG S++E++ +HEFV+ D+ HPL EI ++LG + Sbjct: 417 YAAVGKWDGAGKVRSLMKARGVKKRPGHSTVEIDGDVHEFVSGDQSHPLAGEIGQMLGLL 476 Query: 110 IKNMEAYSSSADG 72 M Y G Sbjct: 477 WHEMTRYGCDVHG 489 >gb|AEU08424.1| pentatricopeptide repeat protein [Physcomitrium pyriforme] Length = 151 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 3/65 (4%) Frame = -3 Query: 278 AAVGMWDEKMIVRAQIKH---RRSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSMI 108 AA G W++K++VR ++ R+ PG S IEV++ IH FV D HP +EIY L +I Sbjct: 1 AATGKWEQKLLVRKMMQRKGIRKEPGRSWIEVDNRIHSFVVGDTSHPESKEIYAQLNDLI 60 Query: 107 KNMEA 93 K ++A Sbjct: 61 KRLKA 65 >ref|XP_003573036.1| PREDICTED: pentatricopeptide repeat-containing protein At1g05750, chloroplastic-like [Brachypodium distachyon] Length = 484 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/64 (43%), Positives = 40/64 (62%), Gaps = 3/64 (4%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHR---RSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YAAVG W VR+ +K R + PG S++E++ +HEFV D+ HP RE++EVLG + Sbjct: 416 YAAVGKWGGAGKVRSLMKSRGVKKRPGQSTVEIDGEVHEFVCGDRSHPQAREVFEVLGLL 475 Query: 110 IKNM 99 M Sbjct: 476 THEM 479 >ref|XP_004229576.1| PREDICTED: pentatricopeptide repeat-containing protein At4g37380, chloroplastic-like [Solanum lycopersicum] Length = 624 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/67 (47%), Positives = 42/67 (62%), Gaps = 3/67 (4%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHR---RSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YAA G WD VRA +K + PG SSIEV + +HEF+A D KHP +EIY +L + Sbjct: 465 YAASGDWDGVAKVRALMKRSGVDKEPGCSSIEVNNKVHEFLAGDMKHPKSKEIYIMLEEV 524 Query: 110 IKNMEAY 90 K +EA+ Sbjct: 525 NKLLEAH 531 >gb|AEP33771.1| organelle transcript processing 82, partial [Thlaspi arvense] Length = 673 Score = 59.3 bits (142), Expect = 5e-07 Identities = 32/71 (45%), Positives = 41/71 (57%), Gaps = 3/71 (4%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHR---RSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YA G WDE VRA + + + PG SSIE++S +HEF+ DK HP REIY M Sbjct: 514 YATAGEWDEVAKVRALLNGKGMKKVPGCSSIEIDSEVHEFIVGDKLHPRNREIY----GM 569 Query: 110 IKNMEAYSSSA 78 ++ MEA A Sbjct: 570 LEEMEALLEEA 580 >ref|XP_002454621.1| hypothetical protein SORBIDRAFT_04g034420 [Sorghum bicolor] gi|241934452|gb|EES07597.1| hypothetical protein SORBIDRAFT_04g034420 [Sorghum bicolor] Length = 496 Score = 58.9 bits (141), Expect = 7e-07 Identities = 33/79 (41%), Positives = 46/79 (58%), Gaps = 9/79 (11%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHR---RSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YAAVG WD VR+ +K R + PG S +E++ +HEFV++D+ HP EI ++LG + Sbjct: 417 YAAVGKWDGAGKVRSLMKARGVKKRPGHSIVEIDGDVHEFVSSDRSHPQAEEIGQMLGLL 476 Query: 110 IKNMEAY------SSSADG 72 M Y SSS DG Sbjct: 477 RHEMAMYGCDDHGSSSLDG 495 >gb|AEB39778.1| pentatricopeptide repeat protein 77 [Funaria hygrometrica] Length = 1161 Score = 58.5 bits (140), Expect = 9e-07 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 3/72 (4%) Frame = -3 Query: 281 YAAVGMWDEKMIVRAQIKHR---RSPGSSSIEVESGIHEFVAADKKHPLKREIYEVLGSM 111 YAA G WD+ +R ++ R + PG S IEV++ IHEF+AAD+ HP EIYE L + Sbjct: 1002 YAAAGRWDDVAKIRRVMEGRGIRKEPGRSWIEVDNIIHEFIAADRSHPETAEIYEELKRL 1061 Query: 110 IKNMEAYSSSAD 75 ME S D Sbjct: 1062 SLEMERAGYSPD 1073