BLASTX nr result
ID: Akebia22_contig00055613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00055613 (333 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001225270.1| predicted protein [Chaetomium globosum CBS 1... 60 4e-07 >ref|XP_001225270.1| predicted protein [Chaetomium globosum CBS 148.51] gi|88178893|gb|EAQ86361.1| predicted protein [Chaetomium globosum CBS 148.51] Length = 339 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/54 (44%), Positives = 37/54 (68%) Frame = +2 Query: 2 RTPASTDLPACGYFLRDWSVGGCYYTAIQESFMLQYCCGTGHCNAAEPSKFKRS 163 R+PA TD+P CGY + +S C ++++FM+Q+CCG G C++A SK +RS Sbjct: 88 RSPAHTDMPGCGYPIASFSSPVCAVVNLEKTFMVQFCCGLGDCSSAGASKLRRS 141