BLASTX nr result
ID: Akebia22_contig00053873
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00053873 (256 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004140461.1| PREDICTED: pentatricopeptide repeat-containi... 73 5e-11 ref|XP_003635033.1| PREDICTED: putative pentatricopeptide repeat... 73 5e-11 emb|CBI38389.3| unnamed protein product [Vitis vinifera] 73 5e-11 ref|XP_006469338.1| PREDICTED: putative pentatricopeptide repeat... 72 6e-11 ref|XP_006447959.1| hypothetical protein CICLE_v10014595mg [Citr... 72 6e-11 ref|XP_006285932.1| hypothetical protein CARUB_v10007444mg [Caps... 72 6e-11 ref|XP_004167701.1| PREDICTED: pentatricopeptide repeat-containi... 72 6e-11 ref|XP_003635064.1| PREDICTED: putative pentatricopeptide repeat... 72 6e-11 ref|XP_002867333.1| pentatricopeptide repeat-containing protein ... 72 6e-11 emb|CBI18728.3| unnamed protein product [Vitis vinifera] 72 6e-11 ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containi... 72 8e-11 gb|AEB39777.1| pentatricopeptide repeat protein 91 [Funaria hygr... 72 8e-11 ref|XP_007043839.1| Tetratricopeptide repeat-like superfamily pr... 72 1e-10 ref|XP_001764438.1| predicted protein [Physcomitrella patens] gi... 72 1e-10 ref|XP_007154866.1| hypothetical protein PHAVU_003G154400g [Phas... 71 1e-10 ref|XP_006446876.1| hypothetical protein CICLE_v10017898mg [Citr... 71 1e-10 ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 71 1e-10 ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containi... 71 1e-10 gb|AEB39779.1| pentatricopeptide repeat protein 98 [Funaria hygr... 71 1e-10 ref|NP_194799.1| pentatricopeptide repeat-containing protein [Ar... 71 2e-10 >ref|XP_004140461.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like [Cucumis sativus] Length = 697 Score = 72.8 bits (177), Expect = 5e-11 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHTA+KLIS+V R I+VRDANRFH+FQ G CSCGDYW Sbjct: 659 DCHTAIKLISKVANRVIVVRDANRFHHFQNGCCSCGDYW 697 >ref|XP_003635033.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic-like [Vitis vinifera] Length = 650 Score = 72.8 bits (177), Expect = 5e-11 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCH+A+KLI+++T+R I+VRD NRFHYF+ G CSCGDYW Sbjct: 612 DCHSAIKLIAKITRRKIVVRDRNRFHYFENGACSCGDYW 650 >emb|CBI38389.3| unnamed protein product [Vitis vinifera] Length = 614 Score = 72.8 bits (177), Expect = 5e-11 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCH+A+KLI+++T+R I+VRD NRFHYF+ G CSCGDYW Sbjct: 576 DCHSAIKLIAKITRRKIVVRDRNRFHYFENGACSCGDYW 614 >ref|XP_006469338.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic-like [Citrus sinensis] Length = 631 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCH+ +KLI+++TKR IIVRD NRFH+F+ GTCSCGDYW Sbjct: 593 DCHSMIKLIAKITKRKIIVRDRNRFHHFENGTCSCGDYW 631 >ref|XP_006447959.1| hypothetical protein CICLE_v10014595mg [Citrus clementina] gi|557550570|gb|ESR61199.1| hypothetical protein CICLE_v10014595mg [Citrus clementina] Length = 631 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCH+ +KLI+++TKR IIVRD NRFH+F+ GTCSCGDYW Sbjct: 593 DCHSMIKLIAKITKRKIIVRDRNRFHHFENGTCSCGDYW 631 >ref|XP_006285932.1| hypothetical protein CARUB_v10007444mg [Capsella rubella] gi|482554637|gb|EOA18830.1| hypothetical protein CARUB_v10007444mg [Capsella rubella] Length = 790 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHTA KLIS++T+R I+VRDANRFH+F+ G CSCGDYW Sbjct: 752 DCHTATKLISKITERVIVVRDANRFHHFKDGVCSCGDYW 790 >ref|XP_004167701.1| PREDICTED: pentatricopeptide repeat-containing protein At5g39680-like, partial [Cucumis sativus] Length = 390 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHTA+KLIS+V R I+VRDANRFH+FQ G CSCGDYW Sbjct: 352 DCHTAIKLISKVANRVIVVRDANRFHHFQNGYCSCGDYW 390 >ref|XP_003635064.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g59200, chloroplastic-like [Vitis vinifera] Length = 650 Score = 72.4 bits (176), Expect = 6e-11 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCH+A+KLI+++T+R ++VRD NRFHYF+ G CSCGDYW Sbjct: 612 DCHSAIKLIAKITRRKVVVRDRNRFHYFENGACSCGDYW 650 >ref|XP_002867333.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313169|gb|EFH43592.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 792 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHTA KLIS++T+R I+VRDANRFH+F+ G CSCGDYW Sbjct: 754 DCHTATKLISKITERVIVVRDANRFHHFKDGVCSCGDYW 792 >emb|CBI18728.3| unnamed protein product [Vitis vinifera] Length = 607 Score = 72.4 bits (176), Expect = 6e-11 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCH+A+KLI+++T+R ++VRD NRFHYF+ G CSCGDYW Sbjct: 569 DCHSAIKLIAKITRRKVVVRDRNRFHYFENGACSCGDYW 607 >ref|XP_004296063.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33990-like [Fragaria vesca subsp. vesca] Length = 867 Score = 72.0 bits (175), Expect = 8e-11 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHT KLIS +T+R IIVRD+NRFH+F+ GTCSCGDYW Sbjct: 829 DCHTVTKLISVITEREIIVRDSNRFHHFKDGTCSCGDYW 867 >gb|AEB39777.1| pentatricopeptide repeat protein 91 [Funaria hygrometrica] Length = 890 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHTA K IS++ KR I+ RDANRFHYF+ GTCSCGD+W Sbjct: 852 DCHTATKFISKIRKREIVARDANRFHYFKNGTCSCGDFW 890 >ref|XP_007043839.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] gi|508707774|gb|EOX99670.1| Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 833 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCH A+KLIS++ +RNII+RD NRFH+FQ G CSCGDYW Sbjct: 795 DCHAAMKLISKIVQRNIIIRDMNRFHHFQNGICSCGDYW 833 >ref|XP_001764438.1| predicted protein [Physcomitrella patens] gi|54695178|dbj|BAD67154.1| PpPPR_91 [Physcomitrella patens] gi|162684302|gb|EDQ70705.1| predicted protein [Physcomitrella patens] Length = 868 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHTA K IS++ KR I+ RDANRFHYF GTCSCGD+W Sbjct: 830 DCHTATKFISKIRKREIVARDANRFHYFNNGTCSCGDFW 868 >ref|XP_007154866.1| hypothetical protein PHAVU_003G154400g [Phaseolus vulgaris] gi|561028220|gb|ESW26860.1| hypothetical protein PHAVU_003G154400g [Phaseolus vulgaris] Length = 778 Score = 71.2 bits (173), Expect = 1e-10 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHTA K IS++T+R I+VRDANRFH+F+ G+CSCGDYW Sbjct: 740 DCHTATKFISKITERVIVVRDANRFHHFKDGSCSCGDYW 778 >ref|XP_006446876.1| hypothetical protein CICLE_v10017898mg [Citrus clementina] gi|557549487|gb|ESR60116.1| hypothetical protein CICLE_v10017898mg [Citrus clementina] Length = 714 Score = 71.2 bits (173), Expect = 1e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHTA K IS+VT R I+VRDA+RFH+F+ GTCSCGDYW Sbjct: 676 DCHTATKFISKVTGREIVVRDAHRFHHFKDGTCSCGDYW 714 >ref|XP_004157408.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 71.2 bits (173), Expect = 1e-10 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCH+A+K IS++T+R I++RDANRFH+F+ GTCSCGDYW Sbjct: 1535 DCHSAIKCISKLTQREIVLRDANRFHHFRNGTCSCGDYW 1573 >ref|XP_004141438.1| PREDICTED: pentatricopeptide repeat-containing protein At4g33170-like [Cucumis sativus] Length = 1573 Score = 71.2 bits (173), Expect = 1e-10 Identities = 27/39 (69%), Positives = 36/39 (92%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCH+A+K IS++T+R I++RDANRFH+F+ GTCSCGDYW Sbjct: 1535 DCHSAIKCISKLTQREIVLRDANRFHHFRNGTCSCGDYW 1573 >gb|AEB39779.1| pentatricopeptide repeat protein 98 [Funaria hygrometrica] Length = 980 Score = 71.2 bits (173), Expect = 1e-10 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHTA KLIS++TKR II RD+NRFH+F+ G CSCGD+W Sbjct: 942 DCHTATKLISKITKRQIIARDSNRFHHFKDGVCSCGDFW 980 >ref|NP_194799.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75208664|sp|Q9SUH6.1|PP341_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g30700; AltName: Full=Protein DYW9 gi|5725434|emb|CAB52443.1| putative protein [Arabidopsis thaliana] gi|7269971|emb|CAB79788.1| putative protein [Arabidopsis thaliana] gi|332660398|gb|AEE85798.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 792 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 255 DCHTAVKLISEVTKRNIIVRDANRFHYFQCGTCSCGDYW 139 DCHT KLIS++T+R I+VRDANRFH+F+ G CSCGDYW Sbjct: 754 DCHTVTKLISKITERVIVVRDANRFHHFKDGVCSCGDYW 792