BLASTX nr result
ID: Akebia22_contig00053682
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00053682 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007200721.1| hypothetical protein PRUPE_ppa025321mg [Prun... 47 6e-06 >ref|XP_007200721.1| hypothetical protein PRUPE_ppa025321mg [Prunus persica] gi|462396121|gb|EMJ01920.1| hypothetical protein PRUPE_ppa025321mg [Prunus persica] Length = 529 Score = 47.4 bits (111), Expect(2) = 6e-06 Identities = 20/32 (62%), Positives = 26/32 (81%) Frame = -3 Query: 220 TMKGRGVQKKCPGTSWIEIDGKVEEYVASDKS 125 TMK GV+K CPG+SWIE++ KV ++ ASDKS Sbjct: 467 TMKELGVEKGCPGSSWIEMERKVHQFAASDKS 498 Score = 28.1 bits (61), Expect(2) = 6e-06 Identities = 16/29 (55%), Positives = 18/29 (62%) Frame = -1 Query: 129 SLPMSSESCALLIELYEQLRLVNYVPKPG 43 S P SSE LL ELY QL+L VP+ G Sbjct: 498 SHPASSEIYLLLAELYRQLKLDACVPELG 526