BLASTX nr result
ID: Akebia22_contig00053654
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00053654 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78743.1| hypothetical protein VITISV_014185 [Vitis vinifera] 55 8e-06 >emb|CAN78743.1| hypothetical protein VITISV_014185 [Vitis vinifera] Length = 383 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/53 (47%), Positives = 32/53 (60%) Frame = -1 Query: 160 YLDEDSRIWDQGKNGVFSVKSFYEKLMGEHACSPPVVNVWDPKFPSKVAFFVW 2 YL+EDS IW QG+NG F VK Y L + P ++W + P+KVAFF W Sbjct: 51 YLEEDSVIWRQGRNGQFRVKEAYSLLTNPNDTGFPSRSIWVARVPNKVAFFAW 103