BLASTX nr result
ID: Akebia22_contig00053623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00053623 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABN08144.1| RNA-directed DNA polymerase ; HMG-I and HMG-Y, DN... 49 9e-06 >gb|ABN08144.1| RNA-directed DNA polymerase ; HMG-I and HMG-Y, DNA-binding, putative [Medicago truncatula] Length = 195 Score = 48.9 bits (115), Expect(2) = 9e-06 Identities = 25/72 (34%), Positives = 40/72 (55%) Frame = +3 Query: 48 QKRGGIDAKLEL*TATLESKDFKITWIKTEYMGWDLNGRTHKKYVLVKINNHEIQQSHYF 227 + R ++ +LE LE+ F+++ KTEYM W+ +GR + + VK+ +H I Q F Sbjct: 22 ESREEVNGRLETWRQALEAYGFRLSRSKTEYMEWNFSGRRSRSTLEVKVGDHIIPQVTRF 81 Query: 228 RYLAFIVVMDEE 263 +YL V D E Sbjct: 82 KYLGSFVQNDGE 93 Score = 26.2 bits (56), Expect(2) = 9e-06 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +2 Query: 281 KTKVGWLKWTCAIGVLLD 334 + + GWLKW A GVL D Sbjct: 101 RIQAGWLKWRRASGVLCD 118