BLASTX nr result
ID: Akebia22_contig00053577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00053577 (201 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535825.1| conserved hypothetical protein [Ricinus comm... 64 3e-08 ref|XP_002526726.1| conserved hypothetical protein [Ricinus comm... 59 9e-07 ref|XP_002526725.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 ref|XP_002276352.1| PREDICTED: uncharacterized protein LOC100251... 57 4e-06 ref|XP_006473880.1| PREDICTED: uncharacterized protein LOC102616... 56 5e-06 ref|XP_006447115.1| hypothetical protein CICLE_v10015501mg [Citr... 56 6e-06 >ref|XP_002535825.1| conserved hypothetical protein [Ricinus communis] gi|223521814|gb|EEF26558.1| conserved hypothetical protein [Ricinus communis] Length = 377 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/63 (52%), Positives = 46/63 (73%) Frame = -3 Query: 190 HGLNKTQITKLVSKNPSLLLTDPHKFYEPKIKFLHDSLGIFSGPDLVKLLTSDSSFLRCS 11 HG K+QIT L+SK+PS++L D K +PKI+FL DSLG+ + PD+ K+L +D+ L S Sbjct: 84 HGFTKSQITSLISKHPSIILADSEKTLKPKIQFL-DSLGV-AKPDIPKILCTDAQILVSS 141 Query: 10 LKN 2 LKN Sbjct: 142 LKN 144 >ref|XP_002526726.1| conserved hypothetical protein [Ricinus communis] gi|223533915|gb|EEF35640.1| conserved hypothetical protein [Ricinus communis] Length = 272 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/65 (44%), Positives = 45/65 (69%) Frame = -3 Query: 196 QNHGLNKTQITKLVSKNPSLLLTDPHKFYEPKIKFLHDSLGIFSGPDLVKLLTSDSSFLR 17 ++HG +KTQITK++ P++L +DP + PKI+F H S G FSGPD+ K+L++ L Sbjct: 93 KSHGFSKTQITKVIHTRPAVLSSDPERTLLPKIQFFH-SKG-FSGPDIAKILSACPEILH 150 Query: 16 CSLKN 2 S++N Sbjct: 151 TSIEN 155 >ref|XP_002526725.1| conserved hypothetical protein [Ricinus communis] gi|223533914|gb|EEF35639.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 57.8 bits (138), Expect = 2e-06 Identities = 30/66 (45%), Positives = 45/66 (68%) Frame = -3 Query: 199 FQNHGLNKTQITKLVSKNPSLLLTDPHKFYEPKIKFLHDSLGIFSGPDLVKLLTSDSSFL 20 F++HG +KTQITK+V + PS+L ++P K PKI+F H S G+ S PD+ K+L++ L Sbjct: 139 FKSHGFSKTQITKVVHRRPSVLSSNPEKTLLPKIQFFH-SKGL-SSPDIAKILSACPEIL 196 Query: 19 RCSLKN 2 S +N Sbjct: 197 HTSTEN 202 >ref|XP_002276352.1| PREDICTED: uncharacterized protein LOC100251002 [Vitis vinifera] Length = 397 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/66 (42%), Positives = 41/66 (62%) Frame = -3 Query: 199 FQNHGLNKTQITKLVSKNPSLLLTDPHKFYEPKIKFLHDSLGIFSGPDLVKLLTSDSSFL 20 F +HG +KTQ +K+V K P LLL+DP K PK++F + S PD+ K++ S L Sbjct: 94 FNSHGFSKTQTSKIVKKEPQLLLSDPDKTLLPKLQFFYSKGA--SWPDIAKIVVCSPSIL 151 Query: 19 RCSLKN 2 + SL+N Sbjct: 152 KRSLEN 157 >ref|XP_006473880.1| PREDICTED: uncharacterized protein LOC102616380 [Citrus sinensis] Length = 144 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/64 (50%), Positives = 42/64 (65%) Frame = -3 Query: 193 NHGLNKTQITKLVSKNPSLLLTDPHKFYEPKIKFLHDSLGIFSGPDLVKLLTSDSSFLRC 14 + G +K+QI L+SKNP+LLL DP K PKI + +S+GI SG DL K L S+ L Sbjct: 74 SRGFDKSQIATLISKNPTLLLADPEKSLRPKIDYF-ESVGI-SGADLPKFLCSNKQLLVV 131 Query: 13 SLKN 2 SLK+ Sbjct: 132 SLKS 135 >ref|XP_006447115.1| hypothetical protein CICLE_v10015501mg [Citrus clementina] gi|557549726|gb|ESR60355.1| hypothetical protein CICLE_v10015501mg [Citrus clementina] Length = 398 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/64 (50%), Positives = 41/64 (64%) Frame = -3 Query: 193 NHGLNKTQITKLVSKNPSLLLTDPHKFYEPKIKFLHDSLGIFSGPDLVKLLTSDSSFLRC 14 + G K+QI L+SKNP+LLL DP K PKI + +S+GI SG DL K L S+ L Sbjct: 84 SRGFEKSQIATLISKNPTLLLADPEKSLRPKIDYF-ESVGI-SGADLPKFLCSNKQLLVV 141 Query: 13 SLKN 2 SLK+ Sbjct: 142 SLKS 145