BLASTX nr result
ID: Akebia22_contig00053531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00053531 (326 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007201711.1| hypothetical protein PRUPE_ppa003815mg [Prun... 55 8e-06 >ref|XP_007201711.1| hypothetical protein PRUPE_ppa003815mg [Prunus persica] gi|462397111|gb|EMJ02910.1| hypothetical protein PRUPE_ppa003815mg [Prunus persica] Length = 547 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/43 (55%), Positives = 30/43 (69%) Frame = +2 Query: 2 WTVGTKTPAMHLPQHSQRARLLTLPSPIEAQVNESTSNPATNV 130 WTVG++ PA HLP +Q+ RL+ LPSP E V ESTS P +V Sbjct: 505 WTVGSRKPAKHLPPRAQKGRLMVLPSPPETHVGESTSEPGISV 547