BLASTX nr result
ID: Akebia22_contig00053476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00053476 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EIW63024.1| hypothetical protein TRAVEDRAFT_113388 [Trametes ... 57 3e-06 >gb|EIW63024.1| hypothetical protein TRAVEDRAFT_113388 [Trametes versicolor FP-101664 SS1] Length = 450 Score = 56.6 bits (135), Expect = 3e-06 Identities = 31/62 (50%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Frame = -2 Query: 181 SARLACSARPIAPRVRIQNVKPRYASTAAEQNT--GSSHIVAGLAGGSLVFLIGYGYYHF 8 SAR A SAR +A + Q + S++ Q T G+SH+VAGLAGG V L GY +YHF Sbjct: 15 SARYAFSARRVAGKRTFQRFQSTGPSSSVSQQTSFGTSHVVAGLAGGGAVLLGGYAWYHF 74 Query: 7 SG 2 SG Sbjct: 75 SG 76