BLASTX nr result
ID: Akebia22_contig00052416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00052416 (331 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoe... 64 2e-08 >ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] gi|440800957|gb|ELR21983.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] Length = 224 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 1/110 (0%) Frame = +1 Query: 1 AVFKQPGFDVCITNSINATMPHPTFTNVQYIGKAEINYIPANHWY-ERDAARGVTFQVFD 177 AVF + C T +I + H + +++GK+ + + P HW E D F++FD Sbjct: 93 AVFFRGEVATCFTKTIRGNLTHFDLSEAEFLGKSYVYFDPVYHWQLETDRYH---FELFD 149 Query: 178 AQDARRNILRIDFHEERTGRTGQWTFFEFDRAANNKEIYEIPKAIQEQCT 327 + R + ++ F + G+ G WT EFD + ++ ++ I +++ CT Sbjct: 150 TPEPHRELRKVSFFIKPNGKAGSWTMHEFDAGSQDESLFMINDKVKQSCT 199