BLASTX nr result
ID: Akebia22_contig00052183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00052183 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212918.1| hypothetical protein PRUPE_ppa022276mg, part... 40 2e-06 >ref|XP_007212918.1| hypothetical protein PRUPE_ppa022276mg, partial [Prunus persica] gi|462408783|gb|EMJ14117.1| hypothetical protein PRUPE_ppa022276mg, partial [Prunus persica] Length = 388 Score = 39.7 bits (91), Expect(2) = 2e-06 Identities = 18/31 (58%), Positives = 21/31 (67%) Frame = +3 Query: 243 SSWDLGFRRNFNYWEITEVVFLFDLLNSFYL 335 S+WD GFRRN EITEVV L D+L +L Sbjct: 185 SNWDFGFRRNLTEAEITEVVLLMDVLRVIHL 215 Score = 37.7 bits (86), Expect(2) = 2e-06 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +1 Query: 94 YKVGSGDNVRFWEDWW*GNSSLSIQHPSLYACSLKKSCLIKDCLIQSGS 240 + VG+G VRFWED W L P L++ S KK I D +I + + Sbjct: 135 FSVGNGVKVRFWEDQWLKEGLLRELFPRLFSLSRKKEKCIVDFVIDAAT 183