BLASTX nr result
ID: Akebia22_contig00051427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00051427 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMC91197.1| hypothetical protein BAUCODRAFT_318019 [Baudoinia... 64 2e-08 gb|EME39543.1| hypothetical protein DOTSEDRAFT_75267 [Dothistrom... 60 4e-07 gb|EMF10280.1| Pkinase-domain-containing protein [Sphaerulina mu... 59 7e-07 gb|EKG14984.1| hypothetical protein MPH_07884 [Macrophomina phas... 57 2e-06 gb|EPE31854.1| Protein kinase-like (PK-like) [Glarea lozoyensis ... 57 3e-06 ref|XP_007581983.1| putative serine threonine-protein kinase chk... 57 4e-06 >gb|EMC91197.1| hypothetical protein BAUCODRAFT_318019 [Baudoinia compniacensis UAMH 10762] Length = 689 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/72 (43%), Positives = 45/72 (62%) Frame = +1 Query: 1 AQLDFSKRKPKRERTLLSTLNDVRVSQVMNFEPDKHGHEQPPVKVFEKNKKNPVKSSERQ 180 A LDFS+RKP RERT+LS +NDV+V +V+ +PD PPVKV++KN+ + Sbjct: 565 AGLDFSRRKPVRERTMLSAINDVKVERVIETKPDHPDRSAPPVKVWDKNRGPHFNNVNIA 624 Query: 181 DLTVIKEAGGAK 216 +++A G K Sbjct: 625 GQQTVQQANGGK 636 >gb|EME39543.1| hypothetical protein DOTSEDRAFT_75267 [Dothistroma septosporum NZE10] Length = 691 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/49 (57%), Positives = 39/49 (79%) Frame = +1 Query: 1 AQLDFSKRKPKRERTLLSTLNDVRVSQVMNFEPDKHGHEQPPVKVFEKN 147 + LDFSKRKP+RERT+LST+N+V+V V++ +PD PPVKV++KN Sbjct: 571 SDLDFSKRKPQRERTMLSTINEVKVDHVIDSQPD-----MPPVKVWDKN 614 >gb|EMF10280.1| Pkinase-domain-containing protein [Sphaerulina musiva SO2202] Length = 686 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/52 (51%), Positives = 41/52 (78%) Frame = +1 Query: 1 AQLDFSKRKPKRERTLLSTLNDVRVSQVMNFEPDKHGHEQPPVKVFEKNKKN 156 + LDFS RKP+RERT+L+++NDV+VS+++ +PD PPVKV+EKN ++ Sbjct: 565 SSLDFSMRKPQRERTMLASINDVKVSRIIETQPD-----APPVKVWEKNSQS 611 >gb|EKG14984.1| hypothetical protein MPH_07884 [Macrophomina phaseolina MS6] Length = 667 Score = 57.4 bits (137), Expect = 2e-06 Identities = 32/76 (42%), Positives = 46/76 (60%) Frame = +1 Query: 7 LDFSKRKPKRERTLLSTLNDVRVSQVMNFEPDKHGHEQPPVKVFEKNKKNPVKSSERQDL 186 LDF+KRK +RERTLLS++NDV+VS+V+ D PP+K++EKN N +S E+ Sbjct: 566 LDFAKRKVQRERTLLSSINDVKVSKVIELSND-----APPLKIYEKNGYNGSQSVEKSPT 620 Query: 187 TVIKEAGGAKHTNRSE 234 +A K S+ Sbjct: 621 RSKNKARNGKEDTPSK 636 >gb|EPE31854.1| Protein kinase-like (PK-like) [Glarea lozoyensis ATCC 20868] Length = 681 Score = 57.0 bits (136), Expect = 3e-06 Identities = 31/70 (44%), Positives = 43/70 (61%) Frame = +1 Query: 1 AQLDFSKRKPKRERTLLSTLNDVRVSQVMNFEPDKHGHEQPPVKVFEKNKKNPVKSSERQ 180 A LDFSKRK RERTLLS+LNDV++S+V++ + D Q PV+V+ KN + Sbjct: 567 ANLDFSKRKVARERTLLSSLNDVKISKVIDTQTD-----QTPVRVYVKNPNGKPTKGKTD 621 Query: 181 DLTVIKEAGG 210 + + AGG Sbjct: 622 SVKPVTGAGG 631 >ref|XP_007581983.1| putative serine threonine-protein kinase chk2 protein [Neofusicoccum parvum UCRNP2] gi|485926238|gb|EOD50554.1| putative serine threonine-protein kinase chk2 protein [Neofusicoccum parvum UCRNP2] Length = 670 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/57 (49%), Positives = 41/57 (71%) Frame = +1 Query: 1 AQLDFSKRKPKRERTLLSTLNDVRVSQVMNFEPDKHGHEQPPVKVFEKNKKNPVKSS 171 + LDF+KRK +RERTLLS++NDV+VS+V+ ++ PP+K++EKN P SS Sbjct: 569 SNLDFAKRKVQRERTLLSSINDVKVSKVVEL-----ANDAPPLKIYEKNGNQPNGSS 620