BLASTX nr result
ID: Akebia22_contig00051176
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00051176 (272 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EON65349.1| methylsterol monooxygenase [Coniosporium apollini... 75 7e-12 gb|EME41297.1| hypothetical protein DOTSEDRAFT_156069 [Dothistro... 75 7e-12 gb|EMC92919.1| hypothetical protein BAUCODRAFT_77677 [Baudoinia ... 75 7e-12 gb|EHL02219.1| putative Methylsterol monooxygenase [Glarea lozoy... 74 2e-11 ref|XP_003854964.1| ERG25, C-4 methyl sterol oxidase [Zymoseptor... 74 2e-11 gb|EFQ27676.1| fatty acid hydroxylase superfamily protein [Colle... 74 2e-11 ref|XP_007585315.1| putative c-4 methyl sterol oxidase protein [... 74 3e-11 emb|CCD55609.1| similar to C-4 sterol methyl oxidase [Botryotini... 73 5e-11 ref|XP_001547478.1| hypothetical protein BC1G_14068 [Botryotinia... 73 5e-11 gb|ETS83842.1| Methylsterol monooxygenase [Pestalotiopsis fici W... 72 6e-11 gb|ESZ94215.1| putative C-4 methyl sterol oxidase Erg25 [Sclerot... 72 6e-11 gb|EON96620.1| putative c-4 sterol methyl oxidase protein [Togni... 72 6e-11 gb|EHK21303.1| hypothetical protein TRIVIDRAFT_91098 [Trichoderm... 72 6e-11 ref|XP_006962040.1| sterol desaturase-like protein [Trichoderma ... 72 6e-11 ref|XP_001585991.1| hypothetical protein SS1G_13083 [Sclerotinia... 72 6e-11 gb|EOA82593.1| hypothetical protein SETTUDRAFT_121026 [Setosphae... 72 8e-11 ref|XP_007600523.1| fatty acid hydroxylase [Colletotrichum fiori... 72 1e-10 gb|EPQ61725.1| C-4 methyl sterol oxidase [Blumeria graminis f. s... 72 1e-10 gb|ENH77781.1| c-4 methyl sterol oxidase [Colletotrichum orbicul... 72 1e-10 gb|EJP70856.1| fatty acid hydroxylase superfamily protein [Beauv... 72 1e-10 >gb|EON65349.1| methylsterol monooxygenase [Coniosporium apollinis CBS 100218] Length = 369 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHERFIGNYSSSFRWWDY+LDTESG E Sbjct: 319 GADHHDTHHERFIGNYSSSFRWWDYLLDTESGPE 352 >gb|EME41297.1| hypothetical protein DOTSEDRAFT_156069 [Dothistroma septosporum NZE10] Length = 319 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHE+FIGNYSSSFRWWDYVLDTESG E Sbjct: 269 GADHHDTHHEKFIGNYSSSFRWWDYVLDTESGPE 302 >gb|EMC92919.1| hypothetical protein BAUCODRAFT_77677 [Baudoinia compniacensis UAMH 10762] Length = 294 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHE+FIGNYSSSFRWWDYVLDTESG E Sbjct: 244 GADHHDTHHEKFIGNYSSSFRWWDYVLDTESGPE 277 >gb|EHL02219.1| putative Methylsterol monooxygenase [Glarea lozoyensis 74030] gi|512195662|gb|EPE24500.1| hypothetical protein GLAREA_08352 [Glarea lozoyensis ATCC 20868] Length = 306 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GA+HHD HHERFIGNYSSSFRWWDYV+DTESG E Sbjct: 252 GAEHHDVHHERFIGNYSSSFRWWDYVMDTESGPE 285 >ref|XP_003854964.1| ERG25, C-4 methyl sterol oxidase [Zymoseptoria tritici IPO323] gi|339474848|gb|EGP89940.1| ERG25, C-4 methyl sterol oxidase [Zymoseptoria tritici IPO323] Length = 296 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GA+HHD HHE+FIGNYSSSFRWWDYVLDTESG E Sbjct: 244 GAEHHDTHHEKFIGNYSSSFRWWDYVLDTESGPE 277 >gb|EFQ27676.1| fatty acid hydroxylase superfamily protein [Colletotrichum graminicola M1.001] Length = 307 Score = 73.9 bits (180), Expect = 2e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHE+FIGNYSSSFRWWDY LDTE+GVE Sbjct: 255 GADHHDLHHEKFIGNYSSSFRWWDYCLDTEAGVE 288 >ref|XP_007585315.1| putative c-4 methyl sterol oxidase protein [Neofusicoccum parvum UCRNP2] gi|485921511|gb|EOD47214.1| putative c-4 methyl sterol oxidase protein [Neofusicoccum parvum UCRNP2] Length = 313 Score = 73.6 bits (179), Expect = 3e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GA+HHD HHERFIGNY+SSFRWWDYVLDTESG E Sbjct: 263 GAEHHDVHHERFIGNYASSFRWWDYVLDTESGPE 296 >emb|CCD55609.1| similar to C-4 sterol methyl oxidase [Botryotinia fuckeliana T4] Length = 314 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GA+HHD HHE+FIGNY+SSFRWWDYVLDTESG E Sbjct: 251 GAEHHDTHHEKFIGNYASSFRWWDYVLDTESGPE 284 >ref|XP_001547478.1| hypothetical protein BC1G_14068 [Botryotinia fuckeliana B05.10] gi|472241072|gb|EMR85808.1| putative c-4 methyl sterol oxidase protein [Botryotinia fuckeliana BcDW1] Length = 305 Score = 72.8 bits (177), Expect = 5e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GA+HHD HHE+FIGNY+SSFRWWDYVLDTESG E Sbjct: 251 GAEHHDTHHEKFIGNYASSFRWWDYVLDTESGPE 284 >gb|ETS83842.1| Methylsterol monooxygenase [Pestalotiopsis fici W106-1] Length = 305 Score = 72.4 bits (176), Expect = 6e-11 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GA HHD HHERFIGNYSSSFRWWDY+LDTESG E Sbjct: 253 GAHHHDVHHERFIGNYSSSFRWWDYMLDTESGPE 286 >gb|ESZ94215.1| putative C-4 methyl sterol oxidase Erg25 [Sclerotinia borealis F-4157] Length = 302 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GA+HHD HHE+FIGNY+SSFRWWDY+LDTESG E Sbjct: 251 GAEHHDTHHEKFIGNYASSFRWWDYILDTESGPE 284 >gb|EON96620.1| putative c-4 sterol methyl oxidase protein [Togninia minima UCRPA7] Length = 304 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHE+FIGNY+SSFRWWDY+LDTE+G E Sbjct: 252 GADHHDVHHEKFIGNYASSFRWWDYMLDTEAGAE 285 >gb|EHK21303.1| hypothetical protein TRIVIDRAFT_91098 [Trichoderma virens Gv29-8] Length = 304 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHE+FIGNY+SSFRWWDY+LDTE+G E Sbjct: 252 GADHHDMHHEKFIGNYASSFRWWDYMLDTEAGAE 285 >ref|XP_006962040.1| sterol desaturase-like protein [Trichoderma reesei QM6a] gi|340521509|gb|EGR51743.1| sterol desaturase-like protein [Trichoderma reesei QM6a] gi|572282319|gb|ETS05333.1| C-4 sterol methyl oxidase [Trichoderma reesei RUT C-30] Length = 304 Score = 72.4 bits (176), Expect = 6e-11 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHE+FIGNY+SSFRWWDY+LDTE+G E Sbjct: 252 GADHHDMHHEKFIGNYASSFRWWDYMLDTEAGAE 285 >ref|XP_001585991.1| hypothetical protein SS1G_13083 [Sclerotinia sclerotiorum 1980] gi|154698488|gb|EDN98226.1| hypothetical protein SS1G_13083 [Sclerotinia sclerotiorum 1980 UF-70] Length = 302 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHE+FIGNY+SSFRWWDY LDTESG E Sbjct: 251 GADHHDTHHEKFIGNYASSFRWWDYCLDTESGPE 284 >gb|EOA82593.1| hypothetical protein SETTUDRAFT_121026 [Setosphaeria turcica Et28A] Length = 301 Score = 72.0 bits (175), Expect = 8e-11 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GA+HHD HHE+FIGNY+SSFRWWDYVLDTE+G E Sbjct: 251 GAEHHDVHHEKFIGNYASSFRWWDYVLDTEAGAE 284 >ref|XP_007600523.1| fatty acid hydroxylase [Colletotrichum fioriniae PJ7] gi|588893734|gb|EXF75815.1| fatty acid hydroxylase [Colletotrichum fioriniae PJ7] Length = 307 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHE+FIGNY+SSFRWWDY LDTE+G+E Sbjct: 255 GADHHDLHHEKFIGNYASSFRWWDYCLDTEAGLE 288 >gb|EPQ61725.1| C-4 methyl sterol oxidase [Blumeria graminis f. sp. tritici 96224] Length = 301 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GA+HHD HHERFIGNY+SSFRWWDY++DTESG E Sbjct: 251 GAEHHDVHHERFIGNYASSFRWWDYLMDTESGPE 284 >gb|ENH77781.1| c-4 methyl sterol oxidase [Colletotrichum orbiculare MAFF 240422] Length = 307 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHE+FIGNY+SSFRWWDY LDTE+G+E Sbjct: 255 GADHHDLHHEKFIGNYASSFRWWDYCLDTEAGLE 288 >gb|EJP70856.1| fatty acid hydroxylase superfamily protein [Beauveria bassiana ARSEF 2860] Length = 304 Score = 71.6 bits (174), Expect = 1e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 272 GADHHDEHHERFIGNYSSSFRWWDYVLDTESGVE 171 GADHHD HHE+FIGNY+SSFRWWDY LDTE+G E Sbjct: 252 GADHHDVHHEKFIGNYASSFRWWDYFLDTEAGAE 285