BLASTX nr result
ID: Akebia22_contig00050968
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00050968 (235 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHI86053.1| plastid acyl-ACP thioesterase [Vernicia fordii] 56 5e-06 >gb|AHI86053.1| plastid acyl-ACP thioesterase [Vernicia fordii] Length = 418 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = +3 Query: 18 AEEVECEHLLRLESGAEIVRARTMWRPKHTNL*GYCGYI 134 A E+EC+HLLRLE GAEIVR RT WRPK+T+ G G I Sbjct: 375 AGEIECQHLLRLEEGAEIVRGRTEWRPKYTSNFGIMGQI 413