BLASTX nr result
ID: Akebia22_contig00050967
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00050967 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN83506.1| hypothetical protein VITISV_027576 [Vitis vinifera] 69 7e-10 >emb|CAN83506.1| hypothetical protein VITISV_027576 [Vitis vinifera] Length = 1172 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 4 LAHVFSTDQLADLLTKPLPKVRFLFLRDKIGLSCRAPS 117 +AHV STDQLADLLTK LP+ RFLFLRDKIGLSCRAPS Sbjct: 1135 VAHVSSTDQLADLLTKSLPRARFLFLRDKIGLSCRAPS 1172