BLASTX nr result
ID: Akebia22_contig00050759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00050759 (209 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007020971.1| Uncharacterized protein TCM_030985 [Theobrom... 58 2e-06 ref|XP_006366040.1| PREDICTED: putative F-box protein At3g58860-... 57 3e-06 ref|XP_004505454.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 56 6e-06 >ref|XP_007020971.1| Uncharacterized protein TCM_030985 [Theobroma cacao] gi|508720599|gb|EOY12496.1| Uncharacterized protein TCM_030985 [Theobroma cacao] Length = 816 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/68 (42%), Positives = 39/68 (57%) Frame = -2 Query: 208 SLVKLTIRGYCIFKLPMQTCFPRLKNLCLFSFKFSVDHSTEKLFSNFPVLEELAFYQCRW 29 SL+ L +R +C K+P FP LK L L +F + S ++LFS VLEEL QC W Sbjct: 596 SLISLVLRTHCTLKVPTPVRFPSLKVLKLSGVRFKDEQSCQELFSGCLVLEELVLEQCDW 655 Query: 28 EDIEIFYI 5 +I+ YI Sbjct: 656 NNIDEIYI 663 >ref|XP_006366040.1| PREDICTED: putative F-box protein At3g58860-like [Solanum tuberosum] Length = 474 Score = 56.6 bits (135), Expect = 3e-06 Identities = 28/69 (40%), Positives = 39/69 (56%) Frame = -2 Query: 208 SLVKLTIRGYCIFKLPMQTCFPRLKNLCLFSFKFSVDHSTEKLFSNFPVLEELAFYQCRW 29 +L L + C+ +LP TCFP LK L L F D ST++L S+ P+L ELA C W Sbjct: 164 TLTSLKLEMNCVLELPTSTCFPFLKTLHLCLVTFRDDSSTQRLLSSCPMLRELAILDCEW 223 Query: 28 EDIEIFYIS 2 +++ IS Sbjct: 224 MNLKQVAIS 232 >ref|XP_004505454.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g66290-like isoform X1 [Cicer arietinum] gi|502143759|ref|XP_004505455.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At1g66290-like isoform X2 [Cicer arietinum] Length = 463 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/55 (43%), Positives = 37/55 (67%) Frame = -2 Query: 166 LPMQTCFPRLKNLCLFSFKFSVDHSTEKLFSNFPVLEELAFYQCRWEDIEIFYIS 2 +P TCFPRLK L + + F+ + S ++LFS PVL+EL Y C W++I++ I+ Sbjct: 167 VPTGTCFPRLKTLAVSNVTFADEKSAQRLFSVCPVLQELTLYNCYWKNIKLISIT 221