BLASTX nr result
ID: Akebia22_contig00050643
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00050643 (377 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004305762.1| PREDICTED: probable inactive leucine-rich re... 71 1e-10 gb|EXC32297.1| putative inactive leucine-rich repeat receptor-li... 69 5e-10 ref|XP_007204840.1| hypothetical protein PRUPE_ppa026803mg [Prun... 69 7e-10 ref|XP_007217312.1| hypothetical protein PRUPE_ppa016164mg [Prun... 69 9e-10 ref|XP_007024676.1| Leucine-rich repeat protein kinase family pr... 68 1e-09 ref|XP_004157971.1| PREDICTED: probable inactive leucine-rich re... 68 1e-09 ref|XP_004508012.1| PREDICTED: probable inactive leucine-rich re... 68 1e-09 gb|EXB74365.1| putative inactive leucine-rich repeat receptor-li... 67 2e-09 ref|NP_001057063.1| Os06g0198900 [Oryza sativa Japonica Group] g... 67 2e-09 gb|EAZ36151.1| hypothetical protein OsJ_20461 [Oryza sativa Japo... 67 2e-09 gb|EAZ00041.1| hypothetical protein OsI_22042 [Oryza sativa Indi... 67 2e-09 gb|EYU45896.1| hypothetical protein MIMGU_mgv1a025291mg [Mimulus... 67 3e-09 ref|XP_003551100.1| PREDICTED: probable inactive leucine-rich re... 67 3e-09 ref|XP_003541314.1| PREDICTED: probable inactive leucine-rich re... 67 3e-09 ref|XP_007154564.1| hypothetical protein PHAVU_003G129400g [Phas... 67 3e-09 ref|XP_007012600.1| Leucine-rich repeat protein kinase family pr... 67 3e-09 ref|XP_007012599.1| Leucine-rich repeat protein kinase family pr... 67 3e-09 ref|XP_004488098.1| PREDICTED: probable inactive leucine-rich re... 67 3e-09 ref|XP_003547509.1| PREDICTED: probable inactive leucine-rich re... 67 3e-09 ref|XP_006656738.1| PREDICTED: probable inactive leucine-rich re... 66 4e-09 >ref|XP_004305762.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like [Fragaria vesca subsp. vesca] Length = 725 Score = 71.2 bits (173), Expect = 1e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 +LTPLAYHYR+EEKL+VYEY+PK SLLYLLHGDR SS Sbjct: 448 VLTPLAYHYRKEEKLLVYEYIPKSSLLYLLHGDRGSS 484 >gb|EXC32297.1| putative inactive leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 675 Score = 69.3 bits (168), Expect = 5e-10 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 +L+PLAYHYR+EEKL+VYEYVP GSLLYLLHG+R SS Sbjct: 390 VLSPLAYHYRKEEKLVVYEYVPNGSLLYLLHGERGSS 426 >ref|XP_007204840.1| hypothetical protein PRUPE_ppa026803mg [Prunus persica] gi|462400371|gb|EMJ06039.1| hypothetical protein PRUPE_ppa026803mg [Prunus persica] Length = 668 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDR 276 ILTPLAYHYRREEKL++ EY+PKGSLLYLLHGDR Sbjct: 449 ILTPLAYHYRREEKLLISEYIPKGSLLYLLHGDR 482 >ref|XP_007217312.1| hypothetical protein PRUPE_ppa016164mg [Prunus persica] gi|462413462|gb|EMJ18511.1| hypothetical protein PRUPE_ppa016164mg [Prunus persica] Length = 707 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 ILTPLAYHYR+EEKL++YEY+PK SLLY+LHGDR S Sbjct: 437 ILTPLAYHYRKEEKLLIYEYIPKSSLLYILHGDRGPS 473 >ref|XP_007024676.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma cacao] gi|508780042|gb|EOY27298.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma cacao] Length = 684 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 ILTPLAYHYR++EKL VYEY+PKGSLLYLLHGD +S Sbjct: 418 ILTPLAYHYRKDEKLFVYEYLPKGSLLYLLHGDHGTS 454 >ref|XP_004157971.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like [Cucumis sativus] Length = 645 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDR 276 ILTPLAYHYRREEKL+V EY+PKGSLLY+LHGDR Sbjct: 428 ILTPLAYHYRREEKLLVSEYIPKGSLLYVLHGDR 461 >ref|XP_004508012.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like [Cicer arietinum] Length = 612 Score = 67.8 bits (164), Expect = 1e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 ILTPLAYHYRREEKL V EY+PKGSLLY+LHGDR +S Sbjct: 392 ILTPLAYHYRREEKLFVTEYMPKGSLLYVLHGDRGTS 428 >gb|EXB74365.1| putative inactive leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 571 Score = 67.4 bits (163), Expect = 2e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 ILTPLAYHYRREEKL+V EY+ KGSLLY+LHGDR SS Sbjct: 351 ILTPLAYHYRREEKLLVSEYISKGSLLYVLHGDRGSS 387 >ref|NP_001057063.1| Os06g0198900 [Oryza sativa Japonica Group] gi|51091827|dbj|BAD36641.1| putative receptor-like protein kinase 3 [Oryza sativa Japonica Group] gi|113595103|dbj|BAF18977.1| Os06g0198900 [Oryza sativa Japonica Group] gi|215701027|dbj|BAG92451.1| unnamed protein product [Oryza sativa Japonica Group] Length = 693 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDR 276 +L PLAYHYRR+EKL+VYEY+PKGSLLY+LHGDR Sbjct: 421 LLPPLAYHYRRDEKLLVYEYIPKGSLLYVLHGDR 454 >gb|EAZ36151.1| hypothetical protein OsJ_20461 [Oryza sativa Japonica Group] Length = 719 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDR 276 +L PLAYHYRR+EKL+VYEY+PKGSLLY+LHGDR Sbjct: 421 LLPPLAYHYRRDEKLLVYEYIPKGSLLYVLHGDR 454 >gb|EAZ00041.1| hypothetical protein OsI_22042 [Oryza sativa Indica Group] Length = 693 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDR 276 +L PLAYHYRR+EKL+VYEY+PKGSLLY+LHGDR Sbjct: 421 LLPPLAYHYRRDEKLLVYEYIPKGSLLYVLHGDR 454 >gb|EYU45896.1| hypothetical protein MIMGU_mgv1a025291mg [Mimulus guttatus] Length = 633 Score = 67.0 bits (162), Expect = 3e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 +L PLAYHYR+EEKL+VYEY PKG+LL+LLHGDR SS Sbjct: 403 VLAPLAYHYRKEEKLLVYEYQPKGNLLFLLHGDRGSS 439 >ref|XP_003551100.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like [Glycine max] Length = 609 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 I+TPLAYHYR+EEKL V EY+PKGSLLY+LHGDR SS Sbjct: 389 IITPLAYHYRKEEKLFVTEYMPKGSLLYVLHGDRGSS 425 >ref|XP_003541314.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like [Glycine max] Length = 606 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 I+TPLAYHYR+EEKL V EY+PKGSLLY+LHGDR SS Sbjct: 386 IITPLAYHYRKEEKLFVTEYMPKGSLLYVLHGDRGSS 422 >ref|XP_007154564.1| hypothetical protein PHAVU_003G129400g [Phaseolus vulgaris] gi|561027918|gb|ESW26558.1| hypothetical protein PHAVU_003G129400g [Phaseolus vulgaris] Length = 608 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 ILTPLAYHYR+EEKL V EY+PKGSLLY+LHGDR S+ Sbjct: 388 ILTPLAYHYRKEEKLFVTEYMPKGSLLYVLHGDRGSN 424 >ref|XP_007012600.1| Leucine-rich repeat protein kinase family protein, putative isoform 2 [Theobroma cacao] gi|508782963|gb|EOY30219.1| Leucine-rich repeat protein kinase family protein, putative isoform 2 [Theobroma cacao] Length = 467 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDR 276 ILTPLAYH+RREEKLIV EY+PKGSLLY+LHGDR Sbjct: 248 ILTPLAYHFRREEKLIVSEYMPKGSLLYVLHGDR 281 >ref|XP_007012599.1| Leucine-rich repeat protein kinase family protein, putative isoform 1 [Theobroma cacao] gi|508782962|gb|EOY30218.1| Leucine-rich repeat protein kinase family protein, putative isoform 1 [Theobroma cacao] Length = 629 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDR 276 ILTPLAYH+RREEKLIV EY+PKGSLLY+LHGDR Sbjct: 410 ILTPLAYHFRREEKLIVSEYMPKGSLLYVLHGDR 443 >ref|XP_004488098.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like [Cicer arietinum] Length = 628 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 ILTPLAYHYRREEKL V EY PKGSLLY+LHGDR +S Sbjct: 409 ILTPLAYHYRREEKLFVTEYKPKGSLLYVLHGDRGTS 445 >ref|XP_003547509.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like [Glycine max] Length = 615 Score = 66.6 bits (161), Expect = 3e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDRRSS 267 I+TPLAYHYRREEKL + EY+PKGSLLY+LHGDR +S Sbjct: 396 IITPLAYHYRREEKLFITEYMPKGSLLYVLHGDRGTS 432 >ref|XP_006656738.1| PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At5g20690-like, partial [Oryza brachyantha] Length = 643 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -1 Query: 377 ILTPLAYHYRREEKLIVYEYVPKGSLLYLLHGDR 276 +L PLAYHYR++EKL+VYEY+PKGSLLY+LHGDR Sbjct: 363 LLPPLAYHYRKDEKLLVYEYIPKGSLLYVLHGDR 396