BLASTX nr result
ID: Akebia22_contig00049777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00049777 (445 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79623.1| hypothetical protein VITISV_035897 [Vitis vinifera] 47 2e-06 >emb|CAN79623.1| hypothetical protein VITISV_035897 [Vitis vinifera] Length = 471 Score = 47.4 bits (111), Expect(2) = 2e-06 Identities = 19/57 (33%), Positives = 34/57 (59%) Frame = -1 Query: 181 VLSANHILAMGIMLVDFCFMCKSSGELVNHLLIHCSFAY*I*SLFMRMFHIRWVPPC 11 VL+ + + G L + CF C S ++V+HLL+HC+ + + +LF +F + W+ C Sbjct: 374 VLNMDQLQRRGYFLANKCFFCLSKVKMVDHLLLHCAKTWVLWNLFFSLFGVSWILSC 430 Score = 29.6 bits (65), Expect(2) = 2e-06 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = -2 Query: 306 RMFFYQSLTLFPSPSD---FPASTIWGLLDPSEVVFFIW 199 R F +SL P D FP+ +IW P +V FF W Sbjct: 329 RTFSVKSLDSIXEPKDPLLFPSGSIWRXSTPPKVDFFAW 367