BLASTX nr result
ID: Akebia22_contig00047944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00047944 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007032641.1| Pentatricopeptide repeat-containing protein,... 64 2e-08 ref|XP_007224578.1| hypothetical protein PRUPE_ppa1027222mg [Pru... 63 4e-08 tpg|DAA39404.1| TPA: hypothetical protein ZEAMMB73_882385 [Zea m... 63 4e-08 gb|EMT13280.1| hypothetical protein F775_05245 [Aegilops tauschii] 62 8e-08 ref|XP_002885518.1| pentatricopeptide repeat-containing protein ... 62 1e-07 ref|XP_006406136.1| hypothetical protein EUTSA_v10020066mg [Eutr... 61 1e-07 ref|XP_004956000.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_006306854.1| hypothetical protein CARUB_v10008399mg [Caps... 61 1e-07 ref|NP_001189950.1| uncharacterized protein [Arabidopsis thalian... 61 2e-07 ref|XP_006597934.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_007161642.1| hypothetical protein PHAVU_001G086300g [Phas... 61 2e-07 ref|NP_188908.2| uncharacterized protein [Arabidopsis thaliana] ... 61 2e-07 ref|XP_002300144.1| phosphoglycerate/bisphosphoglycerate mutase ... 61 2e-07 gb|EYU45574.1| hypothetical protein MIMGU_mgv1a001941mg [Mimulus... 60 2e-07 ref|XP_006353205.1| PREDICTED: pentatricopeptide repeat-containi... 60 2e-07 ref|XP_007163011.1| hypothetical protein PHAVU_001G198600g [Phas... 60 2e-07 ref|XP_006391028.1| hypothetical protein EUTSA_v10019580mg [Eutr... 60 2e-07 ref|XP_006848707.1| hypothetical protein AMTR_s00177p00030400 [A... 60 2e-07 gb|EMT01545.1| hypothetical protein F775_52571 [Aegilops tauschii] 60 2e-07 ref|NP_564961.1| pentatricopeptide repeat-containing protein [Ar... 60 2e-07 >ref|XP_007032641.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508711670|gb|EOY03567.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 790 Score = 63.9 bits (154), Expect = 2e-08 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = +2 Query: 11 YTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIELDQQ 139 Y L+SN+YAE+GKW+ AR+R +AK+RGL+K PGYS+IELD + Sbjct: 747 YNLVSNLYAESGKWDAAARMRNMAKKRGLKKPPGYSLIELDSE 789 >ref|XP_007224578.1| hypothetical protein PRUPE_ppa1027222mg [Prunus persica] gi|462421514|gb|EMJ25777.1| hypothetical protein PRUPE_ppa1027222mg [Prunus persica] Length = 634 Score = 63.2 bits (152), Expect = 4e-08 Identities = 29/46 (63%), Positives = 35/46 (76%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIELDQQ 139 SG YTL SNIYAE G W+E +R++ K GLRK PGYS+IELD+Q Sbjct: 563 SGYYTLFSNIYAEGGNWDEFGNVRLMMKGIGLRKVPGYSIIELDRQ 608 >tpg|DAA39404.1| TPA: hypothetical protein ZEAMMB73_882385 [Zea mays] Length = 668 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIEL 130 SG Y LLSNIYAEAG W E+ R+RV+ K RG+ K PGYS +EL Sbjct: 499 SGYYVLLSNIYAEAGMWKEVERMRVLVKTRGIEKPPGYSSVEL 541 >gb|EMT13280.1| hypothetical protein F775_05245 [Aegilops tauschii] Length = 641 Score = 62.0 bits (149), Expect = 8e-08 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIEL 130 SG Y LLSNIYAEAG W ++ R+RV+ K RG+ K PGYS +EL Sbjct: 312 SGYYVLLSNIYAEAGMWKDVERMRVLVKTRGIEKPPGYSSVEL 354 >ref|XP_002885518.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297331358|gb|EFH61777.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 904 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/43 (58%), Positives = 37/43 (86%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIEL 130 +G+Y LLSN+YA AG+WN+MA++R+ KE+GLRK PG S+I++ Sbjct: 672 TGSYVLLSNVYASAGRWNDMAKVRLSMKEKGLRKPPGTSVIQI 714 >ref|XP_006406136.1| hypothetical protein EUTSA_v10020066mg [Eutrema salsugineum] gi|557107282|gb|ESQ47589.1| hypothetical protein EUTSA_v10020066mg [Eutrema salsugineum] Length = 836 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/43 (55%), Positives = 37/43 (86%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIEL 130 +G+Y LLSN+YA AG+WN++A++R+ KE+GLRK PG S++E+ Sbjct: 671 TGSYVLLSNVYASAGRWNDVAKVRLSMKEKGLRKPPGTSLVEI 713 >ref|XP_004956000.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X1 [Setaria italica] gi|514726520|ref|XP_004956001.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X2 [Setaria italica] gi|514726524|ref|XP_004956002.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X3 [Setaria italica] gi|514726528|ref|XP_004956003.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X4 [Setaria italica] gi|514726532|ref|XP_004956004.1| PREDICTED: pentatricopeptide repeat-containing protein At3g26782, mitochondrial-like isoform X5 [Setaria italica] Length = 668 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIEL 130 SG Y LLSNIYAEAG W ++ R+RV+ K RG+ K PGYS +EL Sbjct: 499 SGYYVLLSNIYAEAGMWKDVERMRVLFKTRGMEKPPGYSSVEL 541 >ref|XP_006306854.1| hypothetical protein CARUB_v10008399mg [Capsella rubella] gi|482575565|gb|EOA39752.1| hypothetical protein CARUB_v10008399mg [Capsella rubella] Length = 740 Score = 61.2 bits (147), Expect = 1e-07 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIELD 133 SG+Y LLSNIYA AG+WNE+A++R + ++G++K PG S IE+D Sbjct: 571 SGSYVLLSNIYATAGRWNEVAKIRALLNDKGMKKVPGCSSIEID 614 >ref|NP_001189950.1| uncharacterized protein [Arabidopsis thaliana] gi|75274240|sp|Q9LUJ2.1|PP249_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g22690 gi|9279687|dbj|BAB01244.1| unnamed protein product [Arabidopsis thaliana] gi|332643145|gb|AEE76666.1| uncharacterized protein AT3G22690 [Arabidopsis thaliana] Length = 842 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIEL 130 +G+Y LLSN+YA AG+WN+MA++R+ KE+GLRK PG S I++ Sbjct: 673 TGSYVLLSNVYASAGRWNDMAKVRLSMKEKGLRKPPGTSSIQI 715 >ref|XP_006597934.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Glycine max] Length = 734 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/46 (56%), Positives = 37/46 (80%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIELDQQ 139 +G Y LLSNIYA AGKW+++A++R ++RGL+K PGYS +EL+ Q Sbjct: 633 AGNYVLLSNIYAAAGKWDKVAKMRSFLRDRGLKKTPGYSWLELNGQ 678 >ref|XP_007161642.1| hypothetical protein PHAVU_001G086300g [Phaseolus vulgaris] gi|561035106|gb|ESW33636.1| hypothetical protein PHAVU_001G086300g [Phaseolus vulgaris] Length = 669 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +2 Query: 5 GAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIEL 130 G Y LLSNIYA+AG+W+E+ R+R++ K RGL K PG+S++EL Sbjct: 501 GYYVLLSNIYADAGRWDEVERMRILMKNRGLLKTPGFSIVEL 542 >ref|NP_188908.2| uncharacterized protein [Arabidopsis thaliana] gi|332643144|gb|AEE76665.1| uncharacterized protein AT3G22690 [Arabidopsis thaliana] Length = 938 Score = 60.8 bits (146), Expect = 2e-07 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIEL 130 +G+Y LLSN+YA AG+WN+MA++R+ KE+GLRK PG S I++ Sbjct: 673 TGSYVLLSNVYASAGRWNDMAKVRLSMKEKGLRKPPGTSSIQI 715 >ref|XP_002300144.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Populus trichocarpa] gi|222847402|gb|EEE84949.1| phosphoglycerate/bisphosphoglycerate mutase family protein [Populus trichocarpa] Length = 666 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/42 (57%), Positives = 35/42 (83%) Frame = +2 Query: 5 GAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIEL 130 G Y LL+NIYA+AG+W ++ R+R++ K+RGL K PGYS++EL Sbjct: 498 GYYVLLANIYADAGRWKDVERMRILVKDRGLVKPPGYSLVEL 539 >gb|EYU45574.1| hypothetical protein MIMGU_mgv1a001941mg [Mimulus guttatus] Length = 736 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/43 (58%), Positives = 36/43 (83%) Frame = +2 Query: 5 GAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIELD 133 G+Y LLSNIYA AGKW+E+AR+R + K++G++K PG + IE+D Sbjct: 568 GSYILLSNIYARAGKWDEVARIRTLLKDKGMKKVPGSTSIEVD 610 >ref|XP_006353205.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Solanum tuberosum] Length = 592 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/46 (56%), Positives = 34/46 (73%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIELDQQ 139 SG Y +LSNIYAEAG W E+ R+R + KE G+RKQP YS E++ + Sbjct: 496 SGPYIMLSNIYAEAGMWGEVTRVRGLMKEHGIRKQPAYSWTEIENK 541 >ref|XP_007163011.1| hypothetical protein PHAVU_001G198600g [Phaseolus vulgaris] gi|561036475|gb|ESW35005.1| hypothetical protein PHAVU_001G198600g [Phaseolus vulgaris] Length = 622 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/44 (59%), Positives = 35/44 (79%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIELD 133 SG Y LLSNIYA A KW ++ +R + KE+G+RK+PGYS+IE+D Sbjct: 452 SGHYVLLSNIYARANKWKDVTIMRQMMKEKGVRKRPGYSLIEVD 495 >ref|XP_006391028.1| hypothetical protein EUTSA_v10019580mg [Eutrema salsugineum] gi|557087462|gb|ESQ28314.1| hypothetical protein EUTSA_v10019580mg [Eutrema salsugineum] Length = 787 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIELDQQ 139 +G YTLLSNIYAE G+W E R+R K L+K PGYS+IE+DQ+ Sbjct: 704 TGYYTLLSNIYAEEGEWEEFRRMRSAMKSSSLKKVPGYSVIEIDQK 749 >ref|XP_006848707.1| hypothetical protein AMTR_s00177p00030400 [Amborella trichopoda] gi|548852118|gb|ERN10288.1| hypothetical protein AMTR_s00177p00030400 [Amborella trichopoda] Length = 600 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSM 121 SG YTLLSNIYA+AG+W RLR A+ERGL+K PGYS+ Sbjct: 559 SGTYTLLSNIYADAGQWRSAERLRTSARERGLKKIPGYSL 598 >gb|EMT01545.1| hypothetical protein F775_52571 [Aegilops tauschii] Length = 911 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIEL 130 +G YTLLSNIYA AGKW E A++R +RGL+KQPG S IEL Sbjct: 509 AGTYTLLSNIYASAGKWKEAAKIRSEMNDRGLKKQPGCSWIEL 551 >ref|NP_564961.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75168871|sp|Q9C507.1|PP111_ARATH RecName: Full=Putative pentatricopeptide repeat-containing protein At1g69350, mitochondrial; Flags: Precursor gi|12325094|gb|AAG52503.1|AC018364_21 hypothetical protein; 27026-24663 [Arabidopsis thaliana] gi|12597785|gb|AAG60097.1|AC073178_8 PPR-repeat protein, putative [Arabidopsis thaliana] gi|332196793|gb|AEE34914.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 787 Score = 60.5 bits (145), Expect = 2e-07 Identities = 28/46 (60%), Positives = 33/46 (71%) Frame = +2 Query: 2 SGAYTLLSNIYAEAGKWNEMARLRVIAKERGLRKQPGYSMIELDQQ 139 +G YTLLSNIYAE G+W E RLR K L+K PGYS IE+DQ+ Sbjct: 706 TGYYTLLSNIYAEEGEWEEFRRLRSAMKSSNLKKVPGYSAIEIDQK 751