BLASTX nr result
ID: Akebia22_contig00046103
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00046103 (525 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836829.1| hypothetical protein AMTR_s00099p00054090 [A... 70 3e-10 >ref|XP_006836829.1| hypothetical protein AMTR_s00099p00054090 [Amborella trichopoda] gi|548839393|gb|ERM99682.1| hypothetical protein AMTR_s00099p00054090 [Amborella trichopoda] Length = 1058 Score = 70.1 bits (170), Expect = 3e-10 Identities = 39/95 (41%), Positives = 59/95 (62%) Frame = +1 Query: 241 KTVTARTEVTTFPCSIFKKGSSVEVLKQNGNQRVWVSGILECVDGAKALVLFPETDTNGK 420 K +T TE+ F +IF+ G+SVEVLKQNG QR+WV G +E ++ ALV F T ++ Sbjct: 200 KVMTVSTEMI-FVSAIFEVGTSVEVLKQNGVQRIWVGGRIERIENGNALVRFAGTTSDEP 258 Query: 421 QDEWVEIDPYSDSIKDSSVINEITPHTDASLPNVR 525 +DE V ++P SD+IK+ + + I L ++R Sbjct: 259 EDELVTLNPESDAIKELRIPDCIPTGRSPFLKSIR 293