BLASTX nr result
ID: Akebia22_contig00045813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00045813 (633 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN68458.1| hypothetical protein VITISV_031449 [Vitis vinifera] 41 1e-06 ref|XP_002524913.1| conserved hypothetical protein [Ricinus comm... 44 6e-06 >emb|CAN68458.1| hypothetical protein VITISV_031449 [Vitis vinifera] Length = 439 Score = 40.8 bits (94), Expect(2) = 1e-06 Identities = 18/41 (43%), Positives = 26/41 (63%) Frame = -1 Query: 243 KKSRDRDDPILNMSRICTSLRYNMKFLQNKLLFFILVCFFN 121 K+ RD DDPI N + + T L ++ L+N+L FF+L FN Sbjct: 149 KQLRDEDDPIFNRTMVLTDLHRDLILLENQLPFFVLETLFN 189 Score = 37.7 bits (86), Expect(2) = 1e-06 Identities = 19/40 (47%), Positives = 25/40 (62%) Frame = -2 Query: 383 KSHRELEERARKCYAPAISLSSNELLKMMIVLVHFITEVF 264 K+ RELE R R CYA I S+E + MM++ FI E+F Sbjct: 104 KAMRELEARTRGCYAEIIKFDSDEFVTMMLLDGCFIIELF 143 >ref|XP_002524913.1| conserved hypothetical protein [Ricinus communis] gi|223535748|gb|EEF37410.1| conserved hypothetical protein [Ricinus communis] Length = 531 Score = 43.9 bits (102), Expect(2) = 6e-06 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = -2 Query: 380 SHRELEERARKCYAPAISLSSNELLKMMIVLVHFITEVF 264 S RE+EERAR CY I LSSNE ++MM++ F+ E+F Sbjct: 165 SVREVEERARSCYEGTIGLSSNEFVEMMVLDGCFVLELF 203 Score = 32.3 bits (72), Expect(2) = 6e-06 Identities = 24/75 (32%), Positives = 37/75 (49%) Frame = -1 Query: 228 RDDPILNMSRICTSLRYNMKFLQNKLLFFILVCFFNAQPVDPYHEPCFFSWIALCFLD*L 49 R+DPI M S++ +M L+N+L FIL Q +P + F + +AL F D L Sbjct: 217 RNDPIFAMRGSMHSIQRDMIMLENQLPLFILDLLLGLQFDNP-DQKGFVAKLALTFFDPL 275 Query: 48 MSKVPQMIPTSKARL 4 M + + K +L Sbjct: 276 MPTDEPLTKSEKNKL 290