BLASTX nr result
ID: Akebia22_contig00045430
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00045430 (245 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADD30865.1| putative RF3 protein [Ximenia americana] 68 1e-09 sp|A6MMK8.1|YCF3_DIOEL RecName: Full=Photosystem I assembly prot... 67 2e-09 gb|AEZ48786.1| photosystem I assembly protein Ycf3, partial [Pot... 67 3e-09 gb|AAZ03961.1| Ycf3 [Acorus americanus] 67 3e-09 gb|AGJ51257.1| photosystem I assembly protein Ycf3 (chloroplast)... 66 4e-09 gb|AAZ03964.1| Ycf3 [Ranunculus macranthus] 66 4e-09 gb|ABU85471.1| photosystem I assembly protein ycf3 [Musa acuminata] 66 4e-09 ref|YP_001294271.1| photosystem I assembly protein ycf3 [Illiciu... 66 4e-09 ref|YP_003433976.1| hypothetical chloroplast RF34 [Typha latifol... 66 6e-09 gb|ABU85378.1| photosystem I assembly protein ycf3 [Elaeis oleif... 66 6e-09 ref|YP_008239094.1| hypothetical chloroplast RF34 (chloroplast) ... 65 7e-09 gb|AGC38247.1| photosystem I assembly protein Ycf3 (chloroplast)... 65 7e-09 ref|YP_003587669.1| photosystem I assembly protein Ycf3 [Anomoch... 65 7e-09 ref|YP_003097577.1| photosystem I assembly protein Ycf3 [Dendroc... 65 7e-09 gb|AAX45879.1| hypothetical chloroplast RF3 [Zygnema circumcarin... 65 1e-08 ref|YP_008963481.1| hypothetical chloroplast RF34 (chloroplast) ... 65 1e-08 ref|YP_007475705.1| hypothetical chloroplast RF34 [Zingiber spec... 65 1e-08 ref|YP_008854595.1| hypothetical chloroplast RF34 [Curcuma rosco... 65 1e-08 ref|YP_005089335.1| ycf3 gene product (chloroplast) [Silene vulg... 65 1e-08 ref|YP_001837361.1| photosystem I assembly protein Ycf3 [Guizoti... 65 1e-08 >gb|ADD30865.1| putative RF3 protein [Ximenia americana] Length = 168 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDG 145 M R ++NENFIDK S++ANIL R+IPTTSREKEAFTYYRDG Sbjct: 1 MPRSRVNENFIDKTFSIVANILLRIIPTTSREKEAFTYYRDG 42 >sp|A6MMK8.1|YCF3_DIOEL RecName: Full=Photosystem I assembly protein Ycf3 gi|148668047|gb|ABR01431.1| photosystem I assembly protein ycf3 [Dioscorea elephantipes] Length = 172 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R QIN NFIDK +S++ANIL R+IPTTS EK+AFTYYRDGAI Sbjct: 1 MPRSQINGNFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGAI 44 >gb|AEZ48786.1| photosystem I assembly protein Ycf3, partial [Potarophytum riparium] Length = 172 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK +S+LANIL R+IPTTS EK+AFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTSSILANILLRIIPTTSGEKKAFTYYRDGAI 44 >gb|AAZ03961.1| Ycf3 [Acorus americanus] Length = 170 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK ++++ANIL R+IPTTS EKEAFTYYRDGAI Sbjct: 1 MPRSRINANFIDKTSTIVANILLRIIPTTSGEKEAFTYYRDGAI 44 >gb|AGJ51257.1| photosystem I assembly protein Ycf3 (chloroplast) [Solanum carolinense] Length = 44 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK S++ANIL R+IPTTS EKEAFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRVIPTTSGEKEAFTYYRDGAI 44 >gb|AAZ03964.1| Ycf3 [Ranunculus macranthus] Length = 170 Score = 66.2 bits (160), Expect = 4e-09 Identities = 33/44 (75%), Positives = 37/44 (84%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK S++ANIL R+IPTTS EKEAFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAI 44 >gb|ABU85471.1| photosystem I assembly protein ycf3 [Musa acuminata] Length = 170 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK +S++ANIL R+IPTTS EK+AFTYYRDGAI Sbjct: 1 MPRSRINANFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGAI 44 >ref|YP_001294271.1| photosystem I assembly protein ycf3 [Illicium oligandrum] gi|172048704|sp|A6MMU5.1|YCF3_ILLOL RecName: Full=Photosystem I assembly protein Ycf3 gi|147917396|gb|ABQ52520.1| photosystem I assembly protein ycf3 [Illicium oligandrum] Length = 168 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDG 145 MSR +IN NFIDK +S++ANIL R+IPTTS EKEAFTYYRDG Sbjct: 1 MSRSRINGNFIDKTSSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_003433976.1| hypothetical chloroplast RF34 [Typha latifolia] gi|69216735|gb|AAZ03965.1| Ycf3 [Typha latifolia] gi|281371773|gb|ADA63700.1| hypothetical chloroplast RF34 [Typha latifolia] Length = 172 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK +S++ANIL R+IPTTS EK+AFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGAI 44 >gb|ABU85378.1| photosystem I assembly protein ycf3 [Elaeis oleifera] Length = 172 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/44 (72%), Positives = 38/44 (86%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK +S++ANIL R+IPTTS EK+AFTYYRDGAI Sbjct: 1 MPRSRINVNFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGAI 44 >ref|YP_008239094.1| hypothetical chloroplast RF34 (chloroplast) [Triticum monococcum] gi|525782217|ref|YP_008239173.1| hypothetical chloroplast RF34 (chloroplast) [Secale cereale] gi|533310106|ref|YP_008474301.1| hypothetical chloroplast RF34 (chloroplast) [Aegilops tauschii] gi|533310202|ref|YP_008474392.1| hypothetical chloroplast RF34 (chloroplast) [Aegilops speltoides] gi|568244997|ref|YP_008963905.1| hypothetical chloroplast RF34 (chloroplast) [Aegilops geniculata] gi|568246995|ref|YP_008963828.1| hypothetical chloroplast RF34 (chloroplast) [Aegilops cylindrica] gi|384406853|gb|AFH89510.1| hypothetical chloroplast RF34 (chloroplast) [Aegilops tauschii] gi|394986493|gb|AFN42374.1| hypothetical chloroplast RF34 (chloroplast) [Aegilops speltoides] gi|521301191|gb|AGP50991.1| hypothetical chloroplast RF34 (chloroplast) [Triticum monococcum] gi|521301271|gb|AGP51070.1| hypothetical chloroplast RF34 (chloroplast) [Secale cereale] gi|521301348|gb|AGP51146.1| hypothetical chloroplast RF34 (chloroplast) [Triticum monococcum subsp. aegilopoides] gi|521301488|gb|AGP51284.1| hypothetical chloroplast RF34 (chloroplast) [Triticum aestivum] gi|554515555|gb|AGY92858.1| hypothetical chloroplast RF34 (chloroplast) [Aegilops cylindrica] gi|554515633|gb|AGY92935.1| hypothetical chloroplast RF34 (chloroplast) [Aegilops geniculata] Length = 172 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/44 (70%), Positives = 38/44 (86%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R ++N NFIDK +S++ANIL R+IPTTS EK+AFTYYRDGAI Sbjct: 1 MPRSRVNGNFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGAI 44 >gb|AGC38247.1| photosystem I assembly protein Ycf3 (chloroplast) [Cryptochloa strictiflora] Length = 172 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK +S++ANIL R+IPTTS EK AFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTSSIVANILLRIIPTTSGEKRAFTYYRDGAI 44 >ref|YP_003587669.1| photosystem I assembly protein Ycf3 [Anomochloa marantoidea] gi|251765253|gb|ACT15407.1| photosystem I assembly protein Ycf3 [Anomochloa marantoidea] Length = 172 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK +S++ANIL R+IPTTS EK AFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTSSIVANILLRIIPTTSGEKRAFTYYRDGAI 44 >ref|YP_003097577.1| photosystem I assembly protein Ycf3 [Dendrocalamus latiflorus] gi|339906453|ref|YP_004733246.1| hypothetical chloroplast RF34 [Indocalamus longiauritus] gi|340034028|ref|YP_004733580.1| hypothetical chloroplast RF34 [Phyllostachys edulis] gi|340034199|ref|YP_004733762.1| hypothetical chloroplast RF34 [Acidosasa purpurea] gi|340034367|ref|YP_004733980.1| hypothetical chloroplast RF34 [Phyllostachys nigra var. henonis] gi|340034452|ref|YP_004734103.1| hypothetical chloroplast RF34 [Bambusa emeiensis] gi|340034538|ref|YP_004734187.1| hypothetical chloroplast RF34 [Ferrocalamus rimosivaginus] gi|374249352|ref|YP_005088534.1| ycf3 gene product (chloroplast) [Phyllostachys propinqua] gi|452849484|ref|YP_007475141.1| photosystem I assembly protein Ycf3 (chloroplast) [Arundinaria gigantea] gi|608787559|ref|YP_009024256.1| photosystem I assembly protein Ycf3 (chloroplast) [Arundinaria appalachiana] gi|608787643|ref|YP_009024339.1| photosystem I assembly protein Ycf3 (chloroplast) [Arundinaria tecta] gi|255040261|gb|ACT99921.1| photosystem I assembly protein Ycf3 [Dendrocalamus latiflorus] gi|307133888|gb|ADN32893.1| hypothetical chloroplast RF34 [Phyllostachys nigra var. henonis] gi|309321619|gb|ADO65144.1| hypothetical chloroplast RF34 [Acidosasa purpurea] gi|309321703|gb|ADO65227.1| hypothetical chloroplast RF34 [Ferrocalamus rimosivaginus] gi|309321786|gb|ADO65309.1| hypothetical chloroplast RF34 [Indocalamus longiauritus] gi|309321870|gb|ADO65392.1| hypothetical chloroplast RF34 [Phyllostachys edulis] gi|309321955|gb|ADO65476.1| hypothetical chloroplast RF34 [Bambusa emeiensis] gi|346228389|gb|AEO21262.1| hypothetical chloroplast RF34 (chloroplast) [Phyllostachys propinqua] gi|441480252|gb|AGC38164.1| photosystem I assembly protein Ycf3 (chloroplast) [Arundinaria gigantea] gi|511262227|gb|AGN72221.1| photosystem I assembly protein Ycf3 (chloroplast) [Arundinaria appalachiana] gi|511262311|gb|AGN72304.1| photosystem I assembly protein Ycf3 (chloroplast) [Arundinaria tecta] Length = 172 Score = 65.5 bits (158), Expect = 7e-09 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK +S++ANIL R+IPTTS EK AFTYYRDGAI Sbjct: 1 MPRSRINGNFIDKTSSIVANILLRIIPTTSGEKRAFTYYRDGAI 44 >gb|AAX45879.1| hypothetical chloroplast RF3 [Zygnema circumcarinatum] Length = 186 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = +2 Query: 11 LLTMSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDG 145 L TM R Q N+NFIDK +++A+IL R+IPTT REKEAFTYYRDG Sbjct: 17 LFTMPRSQRNDNFIDKTFTIVADILLRVIPTTQREKEAFTYYRDG 61 >ref|YP_008963481.1| hypothetical chloroplast RF34 (chloroplast) [Penthorum chinense] gi|403226782|gb|AFR25661.1| hypothetical chloroplast RF34 (chloroplast) [Penthorum chinense] Length = 169 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R +IN NFIDK S++ANIL R+IPTTS EKEAFTYYRDGA+ Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGAM 44 >ref|YP_007475705.1| hypothetical chloroplast RF34 [Zingiber spectabile] gi|449326185|gb|AGE92770.1| hypothetical chloroplast RF34 [Zingiber spectabile] Length = 169 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R QIN NFIDK +S++ANIL R+IPTTS EK+AFTYYRDG + Sbjct: 1 MPRSQINANFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGML 44 >ref|YP_008854595.1| hypothetical chloroplast RF34 [Curcuma roscoeana] gi|374411597|gb|AEZ48789.1| photosystem I assembly protein Ycf3, partial [Renealmia alpinia] gi|449326793|gb|AGE93371.1| hypothetical chloroplast RF34 [Alpinia zerumbet] gi|557637502|gb|AHA13097.1| hypothetical chloroplast RF34 [Curcuma roscoeana] Length = 168 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDGAI 151 M R QIN NFIDK +S++ANIL R+IPTTS EK+AFTYYRDG + Sbjct: 1 MPRSQINANFIDKTSSIVANILLRIIPTTSGEKKAFTYYRDGML 44 >ref|YP_005089335.1| ycf3 gene product (chloroplast) [Silene vulgaris] gi|374249789|ref|YP_005089418.1| ycf3 gene product (chloroplast) [Silene noctiflora] gi|374249878|ref|YP_005089506.1| ycf3 gene product (chloroplast) [Silene conica] gi|374249951|ref|YP_005089578.1| ycf3 gene product (chloroplast) [Silene latifolia] gi|575925640|ref|YP_009000025.1| hypothetical chloroplast RF34 (chloroplast) [Silene conoidea] gi|329755449|gb|AEC04013.1| hypothetical chloroplast RF34 (chloroplast) [Silene conica] gi|329755522|gb|AEC04085.1| hypothetical chloroplast RF34 (chloroplast) [Silene latifolia] gi|329755606|gb|AEC04168.1| hypothetical chloroplast RF34 (chloroplast) [Silene noctiflora] gi|329755687|gb|AEC04248.1| hypothetical chloroplast RF34 (chloroplast) [Silene vulgaris] gi|555944112|gb|AGZ18015.1| hypothetical chloroplast RF34 (chloroplast) [Silene conoidea] Length = 168 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDG 145 MSR +IN NFIDK S++ANIL R+IPTTS EKEAFTYYRDG Sbjct: 1 MSRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42 >ref|YP_001837361.1| photosystem I assembly protein Ycf3 [Guizotia abyssinica] gi|179366257|gb|ACB86528.1| hypothetical chloroplast RF34 [Guizotia abyssinica] Length = 168 Score = 65.1 bits (157), Expect = 1e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +2 Query: 20 MSRWQINENFIDKRTSLLANILSRMIPTTSREKEAFTYYRDG 145 MSR +IN NFIDK S++ANIL R+IPTTS EKEAFTYYRDG Sbjct: 1 MSRERINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDG 42