BLASTX nr result
ID: Akebia22_contig00044385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00044385 (263 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006433792.1| hypothetical protein CICLE_v10001834mg [Citr... 56 5e-06 ref|XP_006433791.1| hypothetical protein CICLE_v10001834mg [Citr... 56 5e-06 ref|XP_006472427.1| PREDICTED: neuroguidin-like isoform X1 [Citr... 55 8e-06 >ref|XP_006433792.1| hypothetical protein CICLE_v10001834mg [Citrus clementina] gi|557535914|gb|ESR47032.1| hypothetical protein CICLE_v10001834mg [Citrus clementina] Length = 323 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 126 MDDKSNSSALNDETVKKETPQLVALLKEMKEGLDVVRSKVQA 1 M++ + + +++DE VKKE PQL ALLKEMKEGLD +RSKVQ+ Sbjct: 1 MEEATGNHSISDERVKKEAPQLAALLKEMKEGLDKLRSKVQS 42 >ref|XP_006433791.1| hypothetical protein CICLE_v10001834mg [Citrus clementina] gi|557535913|gb|ESR47031.1| hypothetical protein CICLE_v10001834mg [Citrus clementina] Length = 325 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/42 (61%), Positives = 35/42 (83%) Frame = -3 Query: 126 MDDKSNSSALNDETVKKETPQLVALLKEMKEGLDVVRSKVQA 1 M++ + + +++DE VKKE PQL ALLKEMKEGLD +RSKVQ+ Sbjct: 1 MEEATGNHSISDERVKKEAPQLAALLKEMKEGLDKLRSKVQS 42 >ref|XP_006472427.1| PREDICTED: neuroguidin-like isoform X1 [Citrus sinensis] gi|568836815|ref|XP_006472428.1| PREDICTED: neuroguidin-like isoform X2 [Citrus sinensis] Length = 323 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 126 MDDKSNSSALNDETVKKETPQLVALLKEMKEGLDVVRSKVQ 4 MD+ + + + +DE VKKE PQL ALL+EMKEGLD +RSKVQ Sbjct: 1 MDEATGNHSFSDERVKKEAPQLAALLREMKEGLDKLRSKVQ 41