BLASTX nr result
ID: Akebia22_contig00040932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00040932 (580 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN79789.1| hypothetical protein VITISV_039779 [Vitis vinifera] 34 7e-06 >emb|CAN79789.1| hypothetical protein VITISV_039779 [Vitis vinifera] Length = 1566 Score = 34.3 bits (77), Expect(3) = 7e-06 Identities = 16/33 (48%), Positives = 22/33 (66%) Frame = -2 Query: 150 RILTIDNLMAKGFSTGDFYFLCKGSGETINHIL 52 ++LT D+L +G+S + FLC ETINHIL Sbjct: 1424 KVLTQDHLKRRGWSLANRCFLCCDDEETINHIL 1456 Score = 32.7 bits (73), Expect(3) = 7e-06 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = -1 Query: 457 ENAFVQDYLVWVGDVISWNLGFMRIFND*EVDSQMSLI 344 ++A+V+D ++GD WN F R FND E+++ SL+ Sbjct: 1319 QDAWVEDCWDYMGDAGGWNPCFSRSFNDWELEAVXSLL 1356 Score = 27.7 bits (60), Expect(3) = 7e-06 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -3 Query: 299 VWTKNRNGSFSGKSFYQSLSS 237 VW +++GSFS KS Y +L S Sbjct: 1373 VWNASKSGSFSVKSLYNTLDS 1393