BLASTX nr result
ID: Akebia22_contig00040599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00040599 (506 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] 93 2e-24 emb|CAN71466.1| hypothetical protein VITISV_038987 [Vitis vinifera] 70 3e-10 ref|XP_007137486.1| hypothetical protein PHAVU_009G130900g [Phas... 67 3e-09 >emb|CAN71465.1| hypothetical protein VITISV_038986 [Vitis vinifera] Length = 564 Score = 92.8 bits (229), Expect(2) = 2e-24 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -2 Query: 502 KKGTGPHSPPLGFCFPYLRAHCVSTGEKEVGFTEEEGAGRVLVGP 368 +KGTGPHSPPLGF FPYLRAHCVSTGEKEV FTEEEGAGRVLVGP Sbjct: 387 EKGTGPHSPPLGFFFPYLRAHCVSTGEKEVDFTEEEGAGRVLVGP 431 Score = 45.1 bits (105), Expect(2) = 2e-24 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -1 Query: 359 KCLLDPHPRFPRGGRAVFPQRP 294 + L+ PHPRFPRGGRAVFPQRP Sbjct: 426 RVLVGPHPRFPRGGRAVFPQRP 447 >emb|CAN71466.1| hypothetical protein VITISV_038987 [Vitis vinifera] Length = 325 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 2 FELPFIRFAGAAQHIAGSQRARTTCLTLRSEGP 100 FELPFIRFAGAAQHIAGSQRARTTCLTLRSEGP Sbjct: 293 FELPFIRFAGAAQHIAGSQRARTTCLTLRSEGP 325 >ref|XP_007137486.1| hypothetical protein PHAVU_009G130900g [Phaseolus vulgaris] gi|561010573|gb|ESW09480.1| hypothetical protein PHAVU_009G130900g [Phaseolus vulgaris] Length = 48 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = +3 Query: 159 MTPADLTLPTPGANPLAVLPPRRRTGARVEPLISGVTAVER 281 MTPADL L TPGAN L+VLPP RRTGARVEP + GVTAVER Sbjct: 1 MTPADLNLSTPGANLLSVLPPCRRTGARVEPFLFGVTAVER 41