BLASTX nr result
ID: Akebia22_contig00038487
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00038487 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba]... 83 5e-14 gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] 79 5e-13 ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] g... 66 4e-09 ref|XP_002531802.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 >gb|AGC78894.1| hypothetical protein (mitochondrion) [Vicia faba] gi|442803272|gb|AGC79007.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 602 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/45 (88%), Positives = 40/45 (88%) Frame = +3 Query: 123 MGQRIKRFDFVPRDPPQVGFESRVMGYYPARFGEHL*SALVNGSP 257 MGQRIKRFDFV RD PQVGFESRVMG YPARFGEH SALVNGSP Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGEHFLSALVNGSP 45 >gb|EXB29791.1| hypothetical protein L484_008955 [Morus notabilis] Length = 69 Score = 79.3 bits (194), Expect = 5e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -1 Query: 257 GASIHQRRLQVLSEPCWIVTHHTALKPNLWWIPGDKV 147 GASIHQRRL+VLSEPCWIVTHHTALKPNLWWIP D + Sbjct: 17 GASIHQRRLKVLSEPCWIVTHHTALKPNLWWIPADVI 53 >ref|XP_003588306.1| Ribosomal protein S3 [Medicago truncatula] gi|355477354|gb|AES58557.1| Ribosomal protein S3 [Medicago truncatula] Length = 306 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = +3 Query: 123 MGQRIKRFDFVPRDPPQVGFESRVMGYYPARFGE 224 MGQRIKRFDFV RD PQVGFESRVMG YPARFGE Sbjct: 1 MGQRIKRFDFVSRDSPQVGFESRVMGDYPARFGE 34 >ref|XP_002531802.1| conserved hypothetical protein [Ricinus communis] gi|223528568|gb|EEF30590.1| conserved hypothetical protein [Ricinus communis] Length = 72 Score = 58.2 bits (139), Expect = 1e-06 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = -1 Query: 257 GASIHQRRLQVLSEPCWIVTHHTALKPNLW-WIPGDKVKALDPLPHTLRCSSPPIK 93 G SI Q RL+VL EPC I+T++T GD VKALDPLPHTL+ SS PIK Sbjct: 17 GPSIQQCRLKVLCEPCRIITYYTTHSSQTCDGSQGDNVKALDPLPHTLKGSSTPIK 72