BLASTX nr result
ID: Akebia22_contig00037478
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00037478 (402 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMT14885.1| Putative disease resistance protein RGA1 [Aegilop... 38 1e-05 >gb|EMT14885.1| Putative disease resistance protein RGA1 [Aegilops tauschii] Length = 1727 Score = 38.1 bits (87), Expect(2) = 1e-05 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = -1 Query: 105 LLSDRHIPMEL*GKFYKTTI*LVMVCRAECWTIKK 1 +L D+ +P +L GKFY+T + M+ AECW K+ Sbjct: 480 ILCDKRVPQKLKGKFYRTAVRPAMLYGAECWPTKR 514 Score = 36.6 bits (83), Expect(2) = 1e-05 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = -3 Query: 286 YIECMLFVLDVEERLVKIDGQEISQHDQFCSSGYIIHKDVEMAEDVSHKIR 134 Y+ C EE V +DGQ + Q D F G ++ +D + EDV+H+I+ Sbjct: 418 YMMCDFNTTRCEEEEVSLDGQVVPQKDTFRYLGSMLQEDGGIDEDVNHRIK 468