BLASTX nr result
ID: Akebia22_contig00037383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00037383 (273 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EWC64047.1| hypothetical protein UO65_0574 [Actinokineospora ... 59 7e-07 ref|WP_019877452.1| hypothetical protein [Sporichthya polymorpha] 56 5e-06 >gb|EWC64047.1| hypothetical protein UO65_0574 [Actinokineospora sp. EG49] Length = 361 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 1/81 (1%) Frame = +1 Query: 34 IIDLMNDSGSDKTVYVTMTYDYVDGWPSNMDDMRPVWFDVDQCGLSE-ASPKSQSGAFEI 210 +I+LM+ S K V +T+ + V M + PVW D D CGLSE A P+ S Sbjct: 204 MIELMSMSHQQKDVIITVDLETVPDNTPGMKEATPVWLDADNCGLSEHAVPEGPS----T 259 Query: 211 SAWPWSATLDGEVLGYGGHLH 273 + W W +T+ G +G GGH H Sbjct: 260 TTWDWKSTIKGTFVGAGGHQH 280 >ref|WP_019877452.1| hypothetical protein [Sporichthya polymorpha] Length = 355 Score = 56.2 bits (134), Expect = 5e-06 Identities = 30/92 (32%), Positives = 48/92 (52%), Gaps = 1/92 (1%) Frame = +1 Query: 1 YHVKPSDSFAFIIDLMNDSGSDKTVYVTMTYDYVDGWPSNMDDMRPVWFDVDQCGLSE-A 177 + V+P +A II++MN S + + V+ +V M + PVW D CG SE A Sbjct: 156 FRVQPGP-WAGIIEMMNHSDTPQVVFFETVVHHVPASTPGMKPVTPVWLDAANCGTSEFA 214 Query: 178 SPKSQSGAFEISAWPWSATLDGEVLGYGGHLH 273 P +S + W W+++L G ++ GGH+H Sbjct: 215 VPAGKSA----TPWTWTSSLTGRIVAAGGHVH 242