BLASTX nr result
ID: Akebia22_contig00037364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00037364 (343 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216422.1| hypothetical protein PRUPE_ppa023053mg [Prun... 72 6e-11 ref|XP_004305514.1| PREDICTED: pentatricopeptide repeat-containi... 65 7e-09 ref|XP_007023859.1| Pentatricopeptide repeat (PPR) superfamily p... 64 2e-08 ref|XP_007023858.1| Pentatricopeptide repeat (PPR) superfamily p... 64 2e-08 ref|XP_003632809.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_003542113.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_003546931.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_006368374.1| pentatricopeptide repeat-containing family p... 62 1e-07 ref|XP_004506647.1| PREDICTED: pentatricopeptide repeat-containi... 61 2e-07 ref|XP_007150739.1| hypothetical protein PHAVU_005G176600g [Phas... 60 2e-07 dbj|BAJ53231.1| JHL06P13.11 [Jatropha curcas] 60 3e-07 ref|XP_002517612.1| pentatricopeptide repeat-containing protein,... 60 4e-07 ref|XP_004152354.1| PREDICTED: pentatricopeptide repeat-containi... 59 7e-07 ref|XP_006465489.1| PREDICTED: pentatricopeptide repeat-containi... 57 3e-06 ref|XP_006427243.1| hypothetical protein CICLE_v100249422mg, par... 57 3e-06 ref|XP_006364204.1| PREDICTED: pentatricopeptide repeat-containi... 56 6e-06 >ref|XP_007216422.1| hypothetical protein PRUPE_ppa023053mg [Prunus persica] gi|462412572|gb|EMJ17621.1| hypothetical protein PRUPE_ppa023053mg [Prunus persica] Length = 803 Score = 72.4 bits (176), Expect = 6e-11 Identities = 33/61 (54%), Positives = 47/61 (77%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIH 162 C+EGR++EWKN SF+L +ELQ SL+Y ++LD YLH+G S+A+ +L+ LVE+ KSQ Sbjct: 737 CLEGRSKEWKNIISFDLKDQELQTSLKYLLVLDDYLHQGRPSEATLVLQSLVEEFKSQDQ 796 Query: 161 E 159 E Sbjct: 797 E 797 >ref|XP_004305514.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Fragaria vesca subsp. vesca] Length = 820 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/63 (47%), Positives = 46/63 (73%) Frame = -3 Query: 332 GRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIHEQN 153 GR+++WKN SFNL++KELQ ++RYS ++D H G IS+++ +L+ LVE DKS+ E Sbjct: 757 GRSKDWKNIISFNLNEKELQTAVRYSHIIDFQFHGGKISESTLVLQSLVEVDKSEPQEVE 816 Query: 152 NRE 144 + E Sbjct: 817 DTE 819 >ref|XP_007023859.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 2 [Theobroma cacao] gi|508779225|gb|EOY26481.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 2 [Theobroma cacao] Length = 695 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/64 (48%), Positives = 48/64 (75%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIH 162 C+EG+++EW+ S +L+++ELQ +L+YS LL+QYL GI S AS IL+ L++D S+ Sbjct: 627 CLEGKSKEWRKMISNDLNEQELQTALKYSQLLNQYLPYGITSGASPILKTLIKDCSSR-- 684 Query: 161 EQNN 150 +QNN Sbjct: 685 DQNN 688 >ref|XP_007023858.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|590617686|ref|XP_007023860.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508779224|gb|EOY26480.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] gi|508779226|gb|EOY26482.1| Pentatricopeptide repeat (PPR) superfamily protein, putative isoform 1 [Theobroma cacao] Length = 817 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/64 (48%), Positives = 48/64 (75%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIH 162 C+EG+++EW+ S +L+++ELQ +L+YS LL+QYL GI S AS IL+ L++D S+ Sbjct: 749 CLEGKSKEWRKMISNDLNEQELQTALKYSQLLNQYLPYGITSGASPILKTLIKDCSSR-- 806 Query: 161 EQNN 150 +QNN Sbjct: 807 DQNN 810 >ref|XP_003632809.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Vitis vinifera] Length = 879 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/68 (44%), Positives = 50/68 (73%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIH 162 C+EGR++EWKN S NL+++ELQ+++ YS +LDQYL +G S+AS IL+ + E+ +S Sbjct: 754 CLEGRSKEWKNIVSCNLNERELQIAVNYSSILDQYLPQG-TSEASVILQTMFEECQSHSK 812 Query: 161 EQNNREMN 138 +N +++ Sbjct: 813 VGDNIQVS 820 >ref|XP_003542113.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Glycine max] Length = 825 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/56 (48%), Positives = 45/56 (80%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDK 174 C +G+++EW+N S +L++ ELQ +++YS+ LD+YL++G +S+AS IL+ LVED K Sbjct: 755 CHKGKSKEWRNIISCDLNKIELQTAVKYSLTLDKYLYQGRLSEASVILQTLVEDSK 810 >ref|XP_003546931.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Glycine max] Length = 808 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/56 (44%), Positives = 46/56 (82%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDK 174 C +G+++EW+N S +L++ ELQ +++YS+ LD+YL++G +S+AS IL+ L+E+D+ Sbjct: 751 CHKGKSKEWRNIISCDLNKIELQTAVKYSLTLDKYLYQGRLSEASVILQTLIEEDR 806 >ref|XP_006368374.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550346285|gb|ERP64943.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 826 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/63 (42%), Positives = 44/63 (69%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIH 162 C+EGR++EWKN S L++ ELQ++++YS L+ +L +G+ S+AS++ L+E K I Sbjct: 755 CLEGRSKEWKNTISCKLNEWELQIAVKYSQKLNPFLPKGLTSEASKVFHTLLEGVKLHIQ 814 Query: 161 EQN 153 E N Sbjct: 815 ENN 817 >ref|XP_004506647.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Cicer arietinum] Length = 825 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/71 (38%), Positives = 45/71 (63%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIH 162 C G +EW+N S +L++ E++ + YS+ LD+YLH G +S+AS IL+ L+ED K Sbjct: 752 CQTGNLKEWRNTISSDLNKIEVRTAFEYSLKLDKYLHHGRLSEASIILQTLIEDSKFSDQ 811 Query: 161 EQNNREMNDLR 129 N+ + +L+ Sbjct: 812 SDKNQRVTNLQ 822 >ref|XP_007150739.1| hypothetical protein PHAVU_005G176600g [Phaseolus vulgaris] gi|561024003|gb|ESW22733.1| hypothetical protein PHAVU_005G176600g [Phaseolus vulgaris] Length = 820 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/67 (40%), Positives = 50/67 (74%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIH 162 C +G+++EW+N S +L + ELQ +++YS+ LD+YL++G +S+AS IL+ +ED S+ Sbjct: 751 CQKGKSKEWRNIISCDLSKIELQTAVKYSLTLDKYLYQGRLSEASVILQTSIED--SKFS 808 Query: 161 EQNNREM 141 EQ ++++ Sbjct: 809 EQPDKDL 815 >dbj|BAJ53231.1| JHL06P13.11 [Jatropha curcas] Length = 826 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/62 (43%), Positives = 43/62 (69%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIH 162 C+EGR ++W N N ++++LQ++++YS LDQ+L G+ SDAS +L+ LVE K + H Sbjct: 749 CLEGRLQDWNNVIPCNFNERQLQIAVKYSEKLDQFLSEGLTSDASLLLQTLVE--KFKFH 806 Query: 161 EQ 156 Q Sbjct: 807 NQ 808 >ref|XP_002517612.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543244|gb|EEF44776.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 794 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/66 (42%), Positives = 44/66 (66%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIH 162 C+EGR+++W N S L+++ELQV+++YS LD +L +G S+AS IL L + Q+ Sbjct: 720 CLEGRSQDWNNVISCKLNERELQVAVKYSEKLDAFLSQGQTSEASLILHSLADQFSLQME 779 Query: 161 EQNNRE 144 E +N E Sbjct: 780 EVDNLE 785 >ref|XP_004152354.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Cucumis sativus] gi|449484425|ref|XP_004156880.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Cucumis sativus] Length = 834 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/64 (40%), Positives = 46/64 (71%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKSQIH 162 C+EG ++EW+N S +L++ ELQ++L+YS+ LD+++ G IS+AS IL+ +++ S Sbjct: 758 CLEGNSKEWRNMISCDLNEGELQIALKYSLELDKFIPEGGISEASGILQAMIKGYVSPNQ 817 Query: 161 EQNN 150 + NN Sbjct: 818 DLNN 821 >ref|XP_006465489.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like [Citrus sinensis] Length = 1259 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/54 (48%), Positives = 40/54 (74%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVED 180 C+EG+++EW NF L++KELQ+S++YS L Q L +G+ S+A IL+ L+ED Sbjct: 1198 CLEGKSKEWTNFIPCILNEKELQISVKYSESLRQCLPQGMASEAPLILQTLLED 1251 >ref|XP_006427243.1| hypothetical protein CICLE_v100249422mg, partial [Citrus clementina] gi|557529233|gb|ESR40483.1| hypothetical protein CICLE_v100249422mg, partial [Citrus clementina] Length = 485 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/54 (48%), Positives = 40/54 (74%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVED 180 C+EG+++EW NF L++KELQ+S++YS L Q L +G+ S+A IL+ L+ED Sbjct: 424 CLEGKSKEWTNFIPCILNEKELQISVKYSESLRQCLPQGMASEAPLILQTLLED 477 >ref|XP_006364204.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like isoform X1 [Solanum tuberosum] gi|565397234|ref|XP_006364205.1| PREDICTED: pentatricopeptide repeat-containing protein At1g52620-like isoform X2 [Solanum tuberosum] Length = 816 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/57 (45%), Positives = 38/57 (66%) Frame = -3 Query: 341 CMEGRAREWKNFFSFNLDQKELQVSLRYSVLLDQYLHRGIISDASRILRFLVEDDKS 171 C++G+A+EWK+ S +L EL +L+YS++ DQYL G S+AS IL L +D S Sbjct: 760 CLDGKAKEWKSIISCSLSATELSFALKYSLIFDQYLSHGFDSEASVILHTLGKDHVS 816