BLASTX nr result
ID: Akebia22_contig00037171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00037171 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63892.1| hypothetical protein VITISV_012658 [Vitis vinifera] 58 2e-06 ref|XP_004156559.1| PREDICTED: putative BTB/POZ domain-containin... 57 3e-06 ref|XP_004137290.1| PREDICTED: putative BTB/POZ domain-containin... 57 3e-06 ref|XP_006853126.1| hypothetical protein AMTR_s00038p00155420 [A... 56 5e-06 >emb|CAN63892.1| hypothetical protein VITISV_012658 [Vitis vinifera] Length = 116 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%) Frame = -3 Query: 302 ELQNDYSVLQNSFEKIN-KQKSLSSWISGWKKFKNSTFFHGKMGSEDMGE 156 ELQ D+S LQ EK+N KQ+S+ SW GWKK KNST F GK+ + G+ Sbjct: 46 ELQRDHSELQRECEKLNNKQRSIPSWTLGWKKIKNSTLFSGKVDGNESGD 95 >ref|XP_004156559.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like [Cucumis sativus] Length = 616 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -3 Query: 302 ELQNDYSVLQNSFEKI-NKQKSLSSWISGWKKFKNSTFFHGKMGSEDMGEMKHSK 141 ELQ+DYS LQ +EKI NKQK+++ W GWKK KNS FH ++ ++ +HS+ Sbjct: 550 ELQSDYSELQQEYEKISNKQKNIAGWGFGWKKIKNS--FHTRIDGDEPAHQRHSR 602 >ref|XP_004137290.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like [Cucumis sativus] Length = 616 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -3 Query: 302 ELQNDYSVLQNSFEKI-NKQKSLSSWISGWKKFKNSTFFHGKMGSEDMGEMKHSK 141 ELQ+DYS LQ +EKI NKQK+++ W GWKK KNS FH ++ ++ +HS+ Sbjct: 550 ELQSDYSELQQEYEKISNKQKNIAGWGFGWKKIKNS--FHTRIDGDEPAHQRHSR 602 >ref|XP_006853126.1| hypothetical protein AMTR_s00038p00155420 [Amborella trichopoda] gi|548856765|gb|ERN14593.1| hypothetical protein AMTR_s00038p00155420 [Amborella trichopoda] Length = 666 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/53 (47%), Positives = 35/53 (66%) Frame = -3 Query: 302 ELQNDYSVLQNSFEKINKQKSLSSWISGWKKFKNSTFFHGKMGSEDMGEMKHS 144 ELQ+DYS LQ+ ++NK K+LS W GW+K KNS F GKM + + E + + Sbjct: 599 ELQHDYSELQHECTRLNKHKNLSVWGFGWRKLKNSALFQGKMYLDQINETQEN 651