BLASTX nr result
ID: Akebia22_contig00037011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00037011 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281517.1| PREDICTED: B3 domain-containing transcriptio... 69 7e-10 emb|CBI32503.3| unnamed protein product [Vitis vinifera] 69 7e-10 emb|CAN82369.1| hypothetical protein VITISV_027620 [Vitis vinifera] 69 7e-10 ref|XP_006384475.1| hypothetical protein POPTR_0004s15410g [Popu... 69 9e-10 ref|XP_006384478.1| hypothetical protein POPTR_0004s15430g [Popu... 68 1e-09 ref|XP_007042302.1| Sulfotransferase, putative isoform 1 [Theobr... 66 6e-09 ref|XP_004498232.1| PREDICTED: B3 domain-containing transcriptio... 66 6e-09 gb|ADN97106.1| reduced vernalization response 1 [Gossypium hirsu... 65 7e-09 ref|XP_006379217.1| hypothetical protein POPTR_0009s11170g [Popu... 65 7e-09 ref|XP_007042307.1| Uncharacterized protein TCM_006969 [Theobrom... 65 1e-08 ref|XP_007042312.1| DNA binding protein, putative isoform 4, par... 64 2e-08 ref|XP_007042311.1| DNA binding protein, putative isoform 3 [The... 64 2e-08 ref|XP_007042310.1| DNA binding protein, putative isoform 2 [The... 64 2e-08 ref|XP_007042309.1| DNA binding protein, putative isoform 1 [The... 64 2e-08 gb|EXB63661.1| B3 domain-containing transcription factor VRN1 [M... 64 3e-08 ref|XP_002519145.1| DNA binding protein, putative [Ricinus commu... 64 3e-08 ref|XP_006587228.1| PREDICTED: B3 domain-containing transcriptio... 63 4e-08 ref|XP_006587227.1| PREDICTED: B3 domain-containing transcriptio... 63 4e-08 ref|XP_003535137.1| PREDICTED: B3 domain-containing transcriptio... 63 4e-08 ref|XP_006384474.1| hypothetical protein POPTR_0004s15400g [Popu... 62 6e-08 >ref|XP_002281517.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Vitis vinifera] Length = 407 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCSASQS-CKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 I L+ DG+ W+ RC + +S KL GW EFV +N+L+EGDVC+FEL+ LKVSIF Sbjct: 334 IKLQTSDGKQWHVRCLSGESRVKLSKGWTEFVKDNNLEEGDVCVFELINMEDVVLKVSIF 393 Query: 170 RVVGNA 153 RV+ +A Sbjct: 394 RVLDDA 399 >emb|CBI32503.3| unnamed protein product [Vitis vinifera] Length = 355 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCSASQS-CKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 I L+ DG+ W+ RC + +S KL GW EFV +N+L+EGDVC+FEL+ LKVSIF Sbjct: 282 IKLQTSDGKQWHVRCLSGESRVKLSKGWTEFVKDNNLEEGDVCVFELINMEDVVLKVSIF 341 Query: 170 RVVGNA 153 RV+ +A Sbjct: 342 RVLDDA 347 >emb|CAN82369.1| hypothetical protein VITISV_027620 [Vitis vinifera] Length = 563 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/66 (51%), Positives = 46/66 (69%), Gaps = 1/66 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCSASQS-CKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 I L+ DG+ W+ RC + +S KL GW EFV +N+L+EGDVC+FEL+ LKVSIF Sbjct: 490 IKLQTSDGKQWHVRCLSGESRVKLSKGWTEFVKDNNLEEGDVCVFELINMEDVVLKVSIF 549 Query: 170 RVVGNA 153 RV+ +A Sbjct: 550 RVLDDA 555 >ref|XP_006384475.1| hypothetical protein POPTR_0004s15410g [Populus trichocarpa] gi|550341093|gb|ERP62272.1| hypothetical protein POPTR_0004s15410g [Populus trichocarpa] Length = 340 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/66 (51%), Positives = 45/66 (68%), Gaps = 1/66 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCSASQSCKLLG-GWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 + L+V DG+ W RCS LG GW EFV EN+L+EGDVCIFEL+ + LKV++F Sbjct: 267 VTLQVSDGKQWPVRCSFKDGKAKLGQGWTEFVWENNLEEGDVCIFELIHAKEIVLKVAVF 326 Query: 170 RVVGNA 153 RV+ +A Sbjct: 327 RVLEDA 332 >ref|XP_006384478.1| hypothetical protein POPTR_0004s15430g [Populus trichocarpa] gi|550341096|gb|ERP62275.1| hypothetical protein POPTR_0004s15430g [Populus trichocarpa] Length = 407 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/64 (51%), Positives = 45/64 (70%), Gaps = 2/64 (3%) Frame = -2 Query: 347 IILRVLDGRTWYARCSASQSCKLL--GGWKEFVLENHLKEGDVCIFELVKSCPFELKVSI 174 I L+V DGR W R + +Q +++ GW EF EN+LKEGDVC+FEL+K+ F L+VS+ Sbjct: 337 IKLQVSDGRQWPLRLNKTQRARMIISRGWNEFKRENNLKEGDVCVFELIKNKKFSLQVSM 396 Query: 173 FRVV 162 FR V Sbjct: 397 FRAV 400 >ref|XP_007042302.1| Sulfotransferase, putative isoform 1 [Theobroma cacao] gi|590686178|ref|XP_007042303.1| Sulfotransferase, putative isoform 1 [Theobroma cacao] gi|508706237|gb|EOX98133.1| Sulfotransferase, putative isoform 1 [Theobroma cacao] gi|508706238|gb|EOX98134.1| Sulfotransferase, putative isoform 1 [Theobroma cacao] Length = 416 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = -2 Query: 350 TIILRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSI 174 TI L+V +G+ W RC K GW EFVL+N+L EGDVC+FEL+ + LKV+I Sbjct: 344 TITLQVSEGKKWPVRCIYVDGHLKFCKGWAEFVLDNNLDEGDVCVFELINTEEIVLKVTI 403 Query: 173 FRVVGNA 153 FRV+ +A Sbjct: 404 FRVLEDA 410 >ref|XP_004498232.1| PREDICTED: B3 domain-containing transcription factor VRN1-like [Cicer arietinum] Length = 337 Score = 65.9 bits (159), Expect = 6e-09 Identities = 33/60 (55%), Positives = 43/60 (71%) Frame = -2 Query: 347 IILRVLDGRTWYARCSASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIFR 168 I+L++LDGRTW+AR S K+ GW++FV +N L+ GDVC+FEL KS LKV IFR Sbjct: 248 ILLQLLDGRTWHARYSYG---KIKVGWRKFVEDNKLENGDVCLFELTKSQALTLKVLIFR 304 >gb|ADN97106.1| reduced vernalization response 1 [Gossypium hirsutum] Length = 375 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/62 (54%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 I L++ DGR W RC K GW EF LEN+L EGDVCIFEL++S F LKV++F Sbjct: 272 IKLQLPDGRQWPIRCRYRGGKAKFSQGWYEFTLENNLGEGDVCIFELLRSREFVLKVTVF 331 Query: 170 RV 165 RV Sbjct: 332 RV 333 >ref|XP_006379217.1| hypothetical protein POPTR_0009s11170g [Populus trichocarpa] gi|550331495|gb|ERP57014.1| hypothetical protein POPTR_0009s11170g [Populus trichocarpa] Length = 381 Score = 65.5 bits (158), Expect = 7e-09 Identities = 36/71 (50%), Positives = 45/71 (63%), Gaps = 3/71 (4%) Frame = -2 Query: 347 IILRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 IIL++ DG+ W RC K GW EF LEN+L EGDVCIFEL+KS LKV++F Sbjct: 310 IILQLPDGKQWPVRCLYRGGRAKFSQGWYEFTLENNLGEGDVCIFELLKSRDVVLKVTLF 369 Query: 170 RVV--GNAVQH 144 RV+ G + H Sbjct: 370 RVLEDGGLMNH 380 >ref|XP_007042307.1| Uncharacterized protein TCM_006969 [Theobroma cacao] gi|508706242|gb|EOX98138.1| Uncharacterized protein TCM_006969 [Theobroma cacao] Length = 149 Score = 65.1 bits (157), Expect = 1e-08 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 1/67 (1%) Frame = -2 Query: 350 TIILRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSI 174 TI L+V +G+ W RC K GW EFVL+N+L EGDVC+FEL+ + LKV+I Sbjct: 77 TITLQVSEGKKWPVRCIYVDGHLKFCKGWAEFVLDNNLDEGDVCVFELLNTEEIVLKVTI 136 Query: 173 FRVVGNA 153 FRV+ +A Sbjct: 137 FRVLEDA 143 >ref|XP_007042312.1| DNA binding protein, putative isoform 4, partial [Theobroma cacao] gi|508706247|gb|EOX98143.1| DNA binding protein, putative isoform 4, partial [Theobroma cacao] Length = 247 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 I L++ DG+ W RC K GW EF LEN+L EGDVC+FEL++S F LKV++F Sbjct: 175 IKLQLPDGKQWPVRCLYRGGRAKFSQGWYEFTLENNLGEGDVCVFELLRSREFVLKVTVF 234 Query: 170 RVV 162 RV+ Sbjct: 235 RVL 237 >ref|XP_007042311.1| DNA binding protein, putative isoform 3 [Theobroma cacao] gi|508706246|gb|EOX98142.1| DNA binding protein, putative isoform 3 [Theobroma cacao] Length = 344 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 I L++ DG+ W RC K GW EF LEN+L EGDVC+FEL++S F LKV++F Sbjct: 272 IKLQLPDGKQWPVRCLYRGGRAKFSQGWYEFTLENNLGEGDVCVFELLRSREFVLKVTVF 331 Query: 170 RVV 162 RV+ Sbjct: 332 RVL 334 >ref|XP_007042310.1| DNA binding protein, putative isoform 2 [Theobroma cacao] gi|508706245|gb|EOX98141.1| DNA binding protein, putative isoform 2 [Theobroma cacao] Length = 350 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 I L++ DG+ W RC K GW EF LEN+L EGDVC+FEL++S F LKV++F Sbjct: 278 IKLQLPDGKQWPVRCLYRGGRAKFSQGWYEFTLENNLGEGDVCVFELLRSREFVLKVTVF 337 Query: 170 RVV 162 RV+ Sbjct: 338 RVL 340 >ref|XP_007042309.1| DNA binding protein, putative isoform 1 [Theobroma cacao] gi|508706244|gb|EOX98140.1| DNA binding protein, putative isoform 1 [Theobroma cacao] Length = 305 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/63 (50%), Positives = 42/63 (66%), Gaps = 1/63 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 I L++ DG+ W RC K GW EF LEN+L EGDVC+FEL++S F LKV++F Sbjct: 233 IKLQLPDGKQWPVRCLYRGGRAKFSQGWYEFTLENNLGEGDVCVFELLRSREFVLKVTVF 292 Query: 170 RVV 162 RV+ Sbjct: 293 RVL 295 >gb|EXB63661.1| B3 domain-containing transcription factor VRN1 [Morus notabilis] Length = 467 Score = 63.5 bits (153), Expect = 3e-08 Identities = 32/63 (50%), Positives = 41/63 (65%), Gaps = 1/63 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 I L+ DGR W RC KL GW EF LEN+L EGDVC+FE++K+ LKV++F Sbjct: 381 IKLQTSDGRQWPVRCLYRGGRAKLSQGWYEFTLENNLGEGDVCVFEMLKTREIVLKVTVF 440 Query: 170 RVV 162 RV+ Sbjct: 441 RVL 443 >ref|XP_002519145.1| DNA binding protein, putative [Ricinus communis] gi|223541808|gb|EEF43356.1| DNA binding protein, putative [Ricinus communis] Length = 333 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/66 (50%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIF 171 I L+ DG+ W RC KL GW EF LEN++ EGDVC+FEL+KS LKV++F Sbjct: 254 IKLQSSDGKQWPVRCLYRGGRAKLSQGWYEFTLENNMGEGDVCVFELLKSRDIVLKVTVF 313 Query: 170 RVVGNA 153 RV+ A Sbjct: 314 RVLEGA 319 >ref|XP_006587228.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X3 [Glycine max] Length = 344 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCSASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCP-FELKVSIF 171 +IL VL+GRTW CSA + GGW +F ENHL GDVC+FEL++ KVSIF Sbjct: 269 VILEVLEGRTWPVICSAPT---ITGGWHKFASENHLNVGDVCVFELIQKIQGLAFKVSIF 325 Query: 170 R 168 R Sbjct: 326 R 326 >ref|XP_006587227.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X2 [Glycine max] Length = 359 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCSASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCP-FELKVSIF 171 +IL VL+GRTW CSA + GGW +F ENHL GDVC+FEL++ KVSIF Sbjct: 268 VILEVLEGRTWPVICSAPT---ITGGWHKFASENHLNVGDVCVFELIQKIQGLAFKVSIF 324 Query: 170 R 168 R Sbjct: 325 R 325 >ref|XP_003535137.1| PREDICTED: B3 domain-containing transcription factor VRN1-like isoform X1 [Glycine max] Length = 360 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/61 (52%), Positives = 39/61 (63%), Gaps = 1/61 (1%) Frame = -2 Query: 347 IILRVLDGRTWYARCSASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCP-FELKVSIF 171 +IL VL+GRTW CSA + GGW +F ENHL GDVC+FEL++ KVSIF Sbjct: 269 VILEVLEGRTWPVICSAPT---ITGGWHKFASENHLNVGDVCVFELIQKIQGLAFKVSIF 325 Query: 170 R 168 R Sbjct: 326 R 326 >ref|XP_006384474.1| hypothetical protein POPTR_0004s15400g [Populus trichocarpa] gi|550341092|gb|ERP62271.1| hypothetical protein POPTR_0004s15400g [Populus trichocarpa] Length = 381 Score = 62.4 bits (150), Expect = 6e-08 Identities = 33/69 (47%), Positives = 43/69 (62%), Gaps = 3/69 (4%) Frame = -2 Query: 341 LRVLDGRTWYARCS-ASQSCKLLGGWKEFVLENHLKEGDVCIFELVKSCPFELKVSIFRV 165 L++ DG+ W RC K GW EF LEN+L EGDVC+FEL+KS LKV++FRV Sbjct: 312 LQLPDGKQWPVRCLYRGGRAKFSQGWYEFTLENNLGEGDVCVFELLKSRDVVLKVTVFRV 371 Query: 164 V--GNAVQH 144 + G + H Sbjct: 372 LEDGGLMNH 380