BLASTX nr result
ID: Akebia22_contig00034437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00034437 (304 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70998.1| hypothetical protein VITISV_023635 [Vitis vinifera] 39 1e-06 emb|CAN81442.1| hypothetical protein VITISV_011546 [Vitis vinifera] 39 2e-06 emb|CAN62734.1| hypothetical protein VITISV_015319 [Vitis vinifera] 45 9e-06 >emb|CAN70998.1| hypothetical protein VITISV_023635 [Vitis vinifera] Length = 501 Score = 38.9 bits (89), Expect(3) = 1e-06 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -2 Query: 270 DSWI*KGSRDGRFSIKLFYALLESNQEVYFPSSIIWRSKIPSKSVFFS 127 DS I K R G+FS+K +Y L+ FP+ +W S+ P ++ FF+ Sbjct: 309 DSLIWKIERKGKFSVKSYYRSLKVENNPLFPAKEVWVSRAPLRTRFFA 356 Score = 30.0 bits (66), Expect(3) = 1e-06 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 53 CRLCKENEEFVDHCLIY 3 C LCKENEE DH LI+ Sbjct: 381 CVLCKENEESTDHILIH 397 Score = 28.1 bits (61), Expect(3) = 1e-06 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 133 FFMWLAILNKPPTIDLLKHKSFVLVNIVVCAK 38 FF W A+ K T+D+L + + +VN V K Sbjct: 354 FFAWEAVWGKISTVDMLMRRGWSMVNRCVLCK 385 >emb|CAN81442.1| hypothetical protein VITISV_011546 [Vitis vinifera] Length = 843 Score = 39.3 bits (90), Expect(3) = 2e-06 Identities = 18/48 (37%), Positives = 28/48 (58%) Frame = -2 Query: 270 DSWI*KGSRDGRFSIKLFYALLESNQEVYFPSSIIWRSKIPSKSVFFS 127 DS I K R G+FS+K +Y L+ FP+ +W S+ P ++ FF+ Sbjct: 651 DSLIWKIERKGKFSVKSYYRSLKVENNPLFPAKEVWGSRAPLRTRFFA 698 Score = 30.0 bits (66), Expect(3) = 2e-06 Identities = 12/17 (70%), Positives = 13/17 (76%) Frame = -3 Query: 53 CRLCKENEEFVDHCLIY 3 C LCKENEE DH LI+ Sbjct: 723 CVLCKENEESTDHILIH 739 Score = 27.3 bits (59), Expect(3) = 2e-06 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 133 FFMWLAILNKPPTIDLLKHKSFVLVNIVVCAK 38 FF W A+ K T+D+L + + +VN V K Sbjct: 696 FFAWEAMWGKISTVDMLMRRGWSMVNRCVLCK 727 >emb|CAN62734.1| hypothetical protein VITISV_015319 [Vitis vinifera] Length = 478 Score = 45.4 bits (106), Expect(3) = 9e-06 Identities = 23/46 (50%), Positives = 28/46 (60%) Frame = -2 Query: 267 SWI*KGSRDGRFSIKLFYALLESNQEVYFPSSIIWRSKIPSKSVFF 130 SW+ S+DG FSIK Y +L+S FPS IIWRS K +FF Sbjct: 342 SWV--KSKDGVFSIKSLYKVLQSASSALFPSKIIWRSCAQPKIIFF 385 Score = 27.3 bits (59), Expect(3) = 9e-06 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 142 KCLFFMWLAILNKPPTIDLLKHKSFVLVN 56 K +FF+W A + T+D L+ K +VL N Sbjct: 381 KIIFFVWEASWGRVLTLDRLQKKGWVLAN 409 Score = 21.2 bits (43), Expect(3) = 9e-06 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = -3 Query: 53 CRLCKENEEFVDHCLIY 3 C LC++ E +DH L++ Sbjct: 411 CFLCQKCGESIDHLLLH 427