BLASTX nr result
ID: Akebia22_contig00034009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00034009 (432 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB82642.1| ATP-citrate synthase [Camellia sinensis] 117 2e-24 ref|XP_006480297.1| PREDICTED: ATP-citrate synthase alpha chain ... 117 2e-24 ref|XP_006428263.1| hypothetical protein CICLE_v10013702mg [Citr... 117 2e-24 ref|XP_007222546.1| hypothetical protein PRUPE_ppa006199mg [Prun... 114 1e-23 ref|XP_003633614.1| PREDICTED: ATP-citrate synthase alpha chain ... 114 1e-23 ref|XP_002280514.1| PREDICTED: ATP-citrate synthase alpha chain ... 114 1e-23 emb|CAN64797.1| hypothetical protein VITISV_017316 [Vitis vinifera] 114 1e-23 ref|XP_002512567.1| ATP-citrate synthase, putative [Ricinus comm... 113 2e-23 ref|XP_006605258.1| PREDICTED: ATP-citrate synthase alpha chain ... 112 4e-23 ref|XP_006840253.1| hypothetical protein AMTR_s00045p00030700 [A... 112 4e-23 ref|XP_006358554.1| PREDICTED: ATP-citrate synthase alpha chain ... 112 7e-23 ref|XP_006417573.1| hypothetical protein EUTSA_v10007711mg [Eutr... 112 7e-23 ref|XP_004230349.1| PREDICTED: ATP-citrate synthase alpha chain ... 112 7e-23 ref|XP_004135571.1| PREDICTED: ATP-citrate synthase alpha chain ... 112 7e-23 ref|XP_006307607.1| hypothetical protein CARUB_v10009231mg [Caps... 111 9e-23 ref|NP_172414.1| ATP-citrate lyase A-3 [Arabidopsis thaliana] gi... 111 9e-23 ref|XP_002889749.1| ATP-citrate lyase A-3 [Arabidopsis lyrata su... 111 9e-23 gb|EXB53828.1| hypothetical protein L484_003263 [Morus notabilis] 111 1e-22 ref|XP_006577202.1| PREDICTED: ATP-citrate synthase alpha chain ... 111 1e-22 ref|XP_003521649.1| PREDICTED: ATP-citrate synthase alpha chain ... 111 1e-22 >gb|AFB82642.1| ATP-citrate synthase [Camellia sinensis] Length = 423 Score = 117 bits (293), Expect = 2e-24 Identities = 55/57 (96%), Positives = 57/57 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMSA 260 KASRMHI+VRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDC+MSA Sbjct: 366 KASRMHIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCIMSA 422 >ref|XP_006480297.1| PREDICTED: ATP-citrate synthase alpha chain protein 2-like [Citrus sinensis] Length = 423 Score = 117 bits (292), Expect = 2e-24 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMSA 260 KA+RMHIFVRRGGPNYQTGLAKMRALGEELG+PLEVYGPEATMTGICKQAIDC+MSA Sbjct: 366 KAARMHIFVRRGGPNYQTGLAKMRALGEELGIPLEVYGPEATMTGICKQAIDCIMSA 422 >ref|XP_006428263.1| hypothetical protein CICLE_v10013702mg [Citrus clementina] gi|557530320|gb|ESR41503.1| hypothetical protein CICLE_v10013702mg [Citrus clementina] Length = 425 Score = 117 bits (292), Expect = 2e-24 Identities = 54/57 (94%), Positives = 57/57 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMSA 260 KA+RMHIFVRRGGPNYQTGLAKMRALGEELG+PLEVYGPEATMTGICKQAIDC+MSA Sbjct: 368 KAARMHIFVRRGGPNYQTGLAKMRALGEELGIPLEVYGPEATMTGICKQAIDCIMSA 424 >ref|XP_007222546.1| hypothetical protein PRUPE_ppa006199mg [Prunus persica] gi|462419482|gb|EMJ23745.1| hypothetical protein PRUPE_ppa006199mg [Prunus persica] Length = 423 Score = 114 bits (285), Expect = 1e-23 Identities = 53/58 (91%), Positives = 56/58 (96%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMSAE 257 KA+RMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAI+C+M E Sbjct: 366 KAARMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIECIMGEE 423 >ref|XP_003633614.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform 2 [Vitis vinifera] Length = 435 Score = 114 bits (285), Expect = 1e-23 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMS 263 KASRMHI+VRRGGPNYQTGLA+MRALGEELG+PLEVYGPEATMTGICKQAIDC+MS Sbjct: 378 KASRMHIYVRRGGPNYQTGLARMRALGEELGIPLEVYGPEATMTGICKQAIDCIMS 433 >ref|XP_002280514.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform 1 [Vitis vinifera] gi|296089834|emb|CBI39653.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 114 bits (285), Expect = 1e-23 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMS 263 KASRMHI+VRRGGPNYQTGLA+MRALGEELG+PLEVYGPEATMTGICKQAIDC+MS Sbjct: 366 KASRMHIYVRRGGPNYQTGLARMRALGEELGIPLEVYGPEATMTGICKQAIDCIMS 421 >emb|CAN64797.1| hypothetical protein VITISV_017316 [Vitis vinifera] Length = 423 Score = 114 bits (285), Expect = 1e-23 Identities = 52/56 (92%), Positives = 56/56 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMS 263 KASRMHI+VRRGGPNYQTGLA+MRALGEELG+PLEVYGPEATMTGICKQAIDC+MS Sbjct: 366 KASRMHIYVRRGGPNYQTGLARMRALGEELGIPLEVYGPEATMTGICKQAIDCIMS 421 >ref|XP_002512567.1| ATP-citrate synthase, putative [Ricinus communis] gi|223548528|gb|EEF50019.1| ATP-citrate synthase, putative [Ricinus communis] Length = 423 Score = 113 bits (283), Expect = 2e-23 Identities = 52/57 (91%), Positives = 56/57 (98%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMSA 260 KA+RMHI+VRRGGPNYQTGLAKMR LGEE+GVPLEVYGPEATMTGICKQAIDC+MSA Sbjct: 366 KAARMHIYVRRGGPNYQTGLAKMRTLGEEVGVPLEVYGPEATMTGICKQAIDCIMSA 422 >ref|XP_006605258.1| PREDICTED: ATP-citrate synthase alpha chain protein 3-like [Glycine max] Length = 242 Score = 112 bits (281), Expect = 4e-23 Identities = 51/56 (91%), Positives = 56/56 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMS 263 KA+RMHI+VRRGGPNYQTGLAKMRALGEELGVP++VYGPEATMTGICKQAIDC+MS Sbjct: 185 KAARMHIYVRRGGPNYQTGLAKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMS 240 >ref|XP_006840253.1| hypothetical protein AMTR_s00045p00030700 [Amborella trichopoda] gi|548841971|gb|ERN01928.1| hypothetical protein AMTR_s00045p00030700 [Amborella trichopoda] Length = 423 Score = 112 bits (281), Expect = 4e-23 Identities = 51/57 (89%), Positives = 56/57 (98%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMSA 260 KASRMH++VRRGGPNYQTGLA+MR LGEELGVPLEVYGPEATMTGICKQAI+C+MSA Sbjct: 366 KASRMHVYVRRGGPNYQTGLARMRVLGEELGVPLEVYGPEATMTGICKQAIECIMSA 422 >ref|XP_006358554.1| PREDICTED: ATP-citrate synthase alpha chain protein 2-like [Solanum tuberosum] Length = 423 Score = 112 bits (279), Expect = 7e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMS 263 KA+RMHI+VRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICK AIDC+MS Sbjct: 366 KAARMHIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKGAIDCIMS 421 >ref|XP_006417573.1| hypothetical protein EUTSA_v10007711mg [Eutrema salsugineum] gi|557095344|gb|ESQ35926.1| hypothetical protein EUTSA_v10007711mg [Eutrema salsugineum] Length = 424 Score = 112 bits (279), Expect = 7e-23 Identities = 51/58 (87%), Positives = 57/58 (98%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMSAE 257 KASRMHI+VRRGGPNYQTGLA+MRALG+ELGVPLEVYGPEATMTGICK+AIDC+M A+ Sbjct: 366 KASRMHIYVRRGGPNYQTGLARMRALGDELGVPLEVYGPEATMTGICKRAIDCIMLAD 423 >ref|XP_004230349.1| PREDICTED: ATP-citrate synthase alpha chain protein 3-like [Solanum lycopersicum] Length = 423 Score = 112 bits (279), Expect = 7e-23 Identities = 52/56 (92%), Positives = 55/56 (98%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMS 263 KA+RMHI+VRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICK AIDC+MS Sbjct: 366 KAARMHIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKGAIDCIMS 421 >ref|XP_004135571.1| PREDICTED: ATP-citrate synthase alpha chain protein 2-like [Cucumis sativus] gi|449508610|ref|XP_004163361.1| PREDICTED: ATP-citrate synthase alpha chain protein 2-like [Cucumis sativus] Length = 423 Score = 112 bits (279), Expect = 7e-23 Identities = 51/57 (89%), Positives = 57/57 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMSA 260 KA+RMHI+VRRGGPNYQTGL+KMRALGEELGVPLEV+GPEATMTGICKQAI+C+MSA Sbjct: 366 KAARMHIYVRRGGPNYQTGLSKMRALGEELGVPLEVFGPEATMTGICKQAIECIMSA 422 >ref|XP_006307607.1| hypothetical protein CARUB_v10009231mg [Capsella rubella] gi|482576318|gb|EOA40505.1| hypothetical protein CARUB_v10009231mg [Capsella rubella] Length = 424 Score = 111 bits (278), Expect = 9e-23 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVM 266 KASRMHI+VRRGGPNYQTGLA+MRALGEELGVPLEVYGPEATMTGICK+AIDC+M Sbjct: 366 KASRMHIYVRRGGPNYQTGLARMRALGEELGVPLEVYGPEATMTGICKRAIDCIM 420 >ref|NP_172414.1| ATP-citrate lyase A-3 [Arabidopsis thaliana] gi|75099788|sp|O80526.1|ACLA3_ARATH RecName: Full=ATP-citrate synthase alpha chain protein 3; Short=ATP-citrate synthase A-3; AltName: Full=ATP-citrate lyase A-3; AltName: Full=Citrate cleavage enzyme A-3 gi|3482918|gb|AAC33203.1| Similar to ATP-citrate-lyase [Arabidopsis thaliana] gi|22022573|gb|AAM83243.1| At1g09430/F19J9_9 [Arabidopsis thaliana] gi|27764922|gb|AAO23582.1| At1g09430/F19J9_9 [Arabidopsis thaliana] gi|332190321|gb|AEE28442.1| ATP-citrate lyase A-3 [Arabidopsis thaliana] Length = 424 Score = 111 bits (278), Expect = 9e-23 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVM 266 KASRMHI+VRRGGPNYQTGLA+MRALGEELGVPLEVYGPEATMTGICK+AIDC+M Sbjct: 366 KASRMHIYVRRGGPNYQTGLARMRALGEELGVPLEVYGPEATMTGICKRAIDCIM 420 >ref|XP_002889749.1| ATP-citrate lyase A-3 [Arabidopsis lyrata subsp. lyrata] gi|297335591|gb|EFH66008.1| ATP-citrate lyase A-3 [Arabidopsis lyrata subsp. lyrata] Length = 424 Score = 111 bits (278), Expect = 9e-23 Identities = 51/55 (92%), Positives = 55/55 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVM 266 KASRMHI+VRRGGPNYQTGLA+MRALGEELGVPLEVYGPEATMTGICK+AIDC+M Sbjct: 366 KASRMHIYVRRGGPNYQTGLARMRALGEELGVPLEVYGPEATMTGICKRAIDCIM 420 >gb|EXB53828.1| hypothetical protein L484_003263 [Morus notabilis] Length = 225 Score = 111 bits (277), Expect = 1e-22 Identities = 51/56 (91%), Positives = 55/56 (98%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMS 263 KA+RMHI+VRRGGPNYQTGLAKMRALGEELG+ LEVYGPEATMTGICKQAIDC+MS Sbjct: 168 KAARMHIYVRRGGPNYQTGLAKMRALGEELGISLEVYGPEATMTGICKQAIDCIMS 223 >ref|XP_006577202.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform X2 [Glycine max] Length = 446 Score = 111 bits (277), Expect = 1e-22 Identities = 50/56 (89%), Positives = 56/56 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMS 263 KA++MHI+VRRGGPNYQTGLAKMRALGEELGVP++VYGPEATMTGICKQAIDC+MS Sbjct: 389 KAAQMHIYVRRGGPNYQTGLAKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMS 444 >ref|XP_003521649.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform X1 [Glycine max] Length = 423 Score = 111 bits (277), Expect = 1e-22 Identities = 50/56 (89%), Positives = 56/56 (100%) Frame = -3 Query: 430 KASRMHIFVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCVMS 263 KA++MHI+VRRGGPNYQTGLAKMRALGEELGVP++VYGPEATMTGICKQAIDC+MS Sbjct: 366 KAAQMHIYVRRGGPNYQTGLAKMRALGEELGVPIQVYGPEATMTGICKQAIDCIMS 421