BLASTX nr result
ID: Akebia22_contig00033787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00033787 (524 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCU76783.1| conidiation-specific protein-like protein [Blume... 57 3e-06 gb|EPQ65852.1| hypothetical protein BGT96224_3565 [Blumeria gram... 57 3e-06 gb|EPE29241.1| hypothetical protein GLAREA_00401 [Glarea lozoyen... 55 8e-06 >emb|CCU76783.1| conidiation-specific protein-like protein [Blumeria graminis f. sp. hordei DH14] Length = 86 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/48 (50%), Positives = 34/48 (70%) Frame = +1 Query: 154 FANLMNQKRGSMDESAAARRASIHDQYQQKGMFGQMWHNFTKGAAPAE 297 F++LM+QKR + D +A ARRAS H+ G FG++WHNFT G P++ Sbjct: 39 FSSLMDQKRNNSDAAAQARRASFHNMKPTPGFFGKIWHNFTLGPTPSK 86 >gb|EPQ65852.1| hypothetical protein BGT96224_3565 [Blumeria graminis f. sp. tritici 96224] Length = 86 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/48 (50%), Positives = 34/48 (70%) Frame = +1 Query: 154 FANLMNQKRGSMDESAAARRASIHDQYQQKGMFGQMWHNFTKGAAPAE 297 F++LM+QKR + D +A ARRAS H+ G FG++WHNFT G P++ Sbjct: 39 FSSLMDQKRNNSDAAAQARRASFHNMKPTPGFFGKIWHNFTLGPTPSK 86 >gb|EPE29241.1| hypothetical protein GLAREA_00401 [Glarea lozoyensis ATCC 20868] Length = 84 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/45 (57%), Positives = 32/45 (71%) Frame = +1 Query: 154 FANLMNQKRGSMDESAAARRASIHDQYQQKGMFGQMWHNFTKGAA 288 F+ L+NQKR S D SAAARRAS +Q G+ G+MW+NFT G A Sbjct: 39 FSGLINQKRNSTDASAAARRASFAEQKPAAGVLGKMWNNFTTGGA 83