BLASTX nr result
ID: Akebia22_contig00033707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00033707 (211 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006836183.1| hypothetical protein AMTR_s00101p00064390 [A... 129 3e-28 gb|ADV78082.1| calcium- and calmodulin-dependent protein kinase,... 129 3e-28 ref|XP_007010660.1| Calcium and calcium/calmodulin-dependent ser... 121 9e-26 ref|XP_006347696.1| PREDICTED: calcium and calcium/calmodulin-de... 121 1e-25 ref|XP_006432551.1| hypothetical protein CICLE_v10000859mg [Citr... 121 1e-25 emb|CCW43374.1| calcium and calmodulin-dependent kinase [Casuari... 120 1e-25 ref|XP_007220443.1| hypothetical protein PRUPE_ppa004207mg [Prun... 117 1e-24 ref|XP_004230058.1| PREDICTED: calcium and calcium/calmodulin-de... 117 1e-24 gb|AAD52092.1|AF087813_1 calcium/calmodulin dependent protein ki... 117 1e-24 ref|XP_004300049.1| PREDICTED: calcium and calcium/calmodulin-de... 117 2e-24 gb|ABQ95545.1| CCaMK [Petunia x hybrida] 117 2e-24 ref|XP_006378841.1| hypothetical protein POPTR_0010s25360g, part... 117 2e-24 gb|ADV78080.1| calcium- and calmodulin-dependent protein kinase,... 117 2e-24 gb|ADV78063.1| calcium- and calmodulin-dependent protein kinase ... 117 2e-24 emb|CBI29153.3| unnamed protein product [Vitis vinifera] 117 2e-24 ref|XP_002273342.1| PREDICTED: calcium and calcium/calmodulin-de... 117 2e-24 ref|XP_004140929.1| PREDICTED: LOW QUALITY PROTEIN: calcium and ... 116 3e-24 gb|ADV78077.1| calcium- and calmodulin-dependent protein kinase,... 116 3e-24 gb|ADV78076.1| calcium- and calmodulin-dependent protein kinase,... 116 3e-24 gb|ADV78062.1| calcium- and calmodulin-dependent protein kinase ... 116 3e-24 >ref|XP_006836183.1| hypothetical protein AMTR_s00101p00064390 [Amborella trichopoda] gi|548838683|gb|ERM99036.1| hypothetical protein AMTR_s00101p00064390 [Amborella trichopoda] Length = 520 Score = 129 bits (325), Expect = 3e-28 Identities = 64/70 (91%), Positives = 65/70 (92%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 L+LELCSGGELFDRIVAQ RYTEAGAA VVRQIASGLG LH ANIVHRDLKPENCLFLNK Sbjct: 119 LILELCSGGELFDRIVAQARYTEAGAAAVVRQIASGLGGLHQANIVHRDLKPENCLFLNK 178 Query: 30 SEGSPLKIMD 1 SE SPLKIMD Sbjct: 179 SEDSPLKIMD 188 >gb|ADV78082.1| calcium- and calmodulin-dependent protein kinase, partial [Amborella trichopoda] Length = 451 Score = 129 bits (325), Expect = 3e-28 Identities = 64/70 (91%), Positives = 65/70 (92%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 L+LELCSGGELFDRIVAQ RYTEAGAA VVRQIASGLG LH ANIVHRDLKPENCLFLNK Sbjct: 91 LILELCSGGELFDRIVAQARYTEAGAAAVVRQIASGLGGLHQANIVHRDLKPENCLFLNK 150 Query: 30 SEGSPLKIMD 1 SE SPLKIMD Sbjct: 151 SEDSPLKIMD 160 >ref|XP_007010660.1| Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase [Theobroma cacao] gi|508727573|gb|EOY19470.1| Calcium and calcium/calmodulin-dependent serine/threonine-protein kinase [Theobroma cacao] Length = 524 Score = 121 bits (304), Expect = 9e-26 Identities = 60/70 (85%), Positives = 63/70 (90%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIVAQERY+EAGAA VV+QIA GL ALH ANIVHRDLKPENCLF NK Sbjct: 123 LVLELCSGGELFDRIVAQERYSEAGAAAVVKQIAQGLAALHQANIVHRDLKPENCLFFNK 182 Query: 30 SEGSPLKIMD 1 S+ S LKIMD Sbjct: 183 SDDSTLKIMD 192 >ref|XP_006347696.1| PREDICTED: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase-like [Solanum tuberosum] Length = 515 Score = 121 bits (303), Expect = 1e-25 Identities = 60/70 (85%), Positives = 61/70 (87%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 L+LELCSGGELFDRIV Q RY EAGAA VVRQIA GL ALH ANIVHRDLKPENCLFLNK Sbjct: 113 LILELCSGGELFDRIVGQARYNEAGAAAVVRQIAKGLEALHGANIVHRDLKPENCLFLNK 172 Query: 30 SEGSPLKIMD 1 E SPLKIMD Sbjct: 173 DENSPLKIMD 182 >ref|XP_006432551.1| hypothetical protein CICLE_v10000859mg [Citrus clementina] gi|568834469|ref|XP_006471350.1| PREDICTED: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase-like [Citrus sinensis] gi|557534673|gb|ESR45791.1| hypothetical protein CICLE_v10000859mg [Citrus clementina] Length = 522 Score = 121 bits (303), Expect = 1e-25 Identities = 59/70 (84%), Positives = 61/70 (87%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 L+LELCSGGELFDRIVAQERY E GAA V+RQIA GL ALH ANIVHRDLKPENCLFLN Sbjct: 120 LILELCSGGELFDRIVAQERYMEVGAAAVIRQIAEGLAALHQANIVHRDLKPENCLFLND 179 Query: 30 SEGSPLKIMD 1 E SPLKIMD Sbjct: 180 REDSPLKIMD 189 >emb|CCW43374.1| calcium and calmodulin-dependent kinase [Casuarina glauca] gi|511630598|emb|CCW43375.1| calcium and calmodulin-dependent kinase [Casuarina glauca] Length = 520 Score = 120 bits (302), Expect = 1e-25 Identities = 60/70 (85%), Positives = 63/70 (90%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIVAQE+Y EAGAA VVRQ+A GL ALH ANIVHRDLKPENCLFL+K Sbjct: 119 LVLELCSGGELFDRIVAQEKYNEAGAAAVVRQLAEGLVALHQANIVHRDLKPENCLFLDK 178 Query: 30 SEGSPLKIMD 1 S SPLKIMD Sbjct: 179 SADSPLKIMD 188 >ref|XP_007220443.1| hypothetical protein PRUPE_ppa004207mg [Prunus persica] gi|462416905|gb|EMJ21642.1| hypothetical protein PRUPE_ppa004207mg [Prunus persica] Length = 523 Score = 117 bits (294), Expect = 1e-24 Identities = 58/70 (82%), Positives = 62/70 (88%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIV QERY+EAGAA VVRQIA GL ALH +NIVHRDLKPENCLFLN Sbjct: 122 LVLELCSGGELFDRIVKQERYSEAGAAAVVRQIAQGLAALHKSNIVHRDLKPENCLFLNN 181 Query: 30 SEGSPLKIMD 1 ++ S LKIMD Sbjct: 182 TDDSSLKIMD 191 >ref|XP_004230058.1| PREDICTED: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase-like [Solanum lycopersicum] Length = 516 Score = 117 bits (294), Expect = 1e-24 Identities = 59/70 (84%), Positives = 60/70 (85%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 L+LELCSGGELFDRIV Q RY EA AA VVRQIA GL ALH ANIVHRDLKPENCLFLNK Sbjct: 114 LILELCSGGELFDRIVGQPRYNEARAASVVRQIAKGLEALHGANIVHRDLKPENCLFLNK 173 Query: 30 SEGSPLKIMD 1 E SPLKIMD Sbjct: 174 DENSPLKIMD 183 >gb|AAD52092.1|AF087813_1 calcium/calmodulin dependent protein kinase [Nicotiana tabacum] gi|6649536|gb|AAF21450.1|U38446_1 calcium/calmodulin dependent protein kinase [Nicotiana tabacum] Length = 517 Score = 117 bits (294), Expect = 1e-24 Identities = 58/70 (82%), Positives = 60/70 (85%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 L+LELCSGGELFDRI Q RY EAGAA VVRQIA GL ALH A+IVHRDLKPENCLFLNK Sbjct: 116 LILELCSGGELFDRIAGQARYNEAGAAAVVRQIAKGLEALHGASIVHRDLKPENCLFLNK 175 Query: 30 SEGSPLKIMD 1 E SPLKIMD Sbjct: 176 DENSPLKIMD 185 >ref|XP_004300049.1| PREDICTED: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase-like [Fragaria vesca subsp. vesca] Length = 523 Score = 117 bits (293), Expect = 2e-24 Identities = 57/70 (81%), Positives = 61/70 (87%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIV +ERY+E GAA VVRQIA GL ALH +NIVHRDLKPENCLFLN Sbjct: 122 LVLELCSGGELFDRIVKEERYSEVGAAAVVRQIAQGLAALHKSNIVHRDLKPENCLFLNS 181 Query: 30 SEGSPLKIMD 1 + SPLKIMD Sbjct: 182 CDDSPLKIMD 191 >gb|ABQ95545.1| CCaMK [Petunia x hybrida] Length = 534 Score = 117 bits (293), Expect = 2e-24 Identities = 58/70 (82%), Positives = 60/70 (85%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 L+LELC GGELFDRIV Q RY EAGAA VVRQIA GL ALH A+IVHRDLKPENCLFLNK Sbjct: 112 LILELCCGGELFDRIVGQARYNEAGAAAVVRQIAKGLEALHGASIVHRDLKPENCLFLNK 171 Query: 30 SEGSPLKIMD 1 E SPLKIMD Sbjct: 172 DENSPLKIMD 181 >ref|XP_006378841.1| hypothetical protein POPTR_0010s25360g, partial [Populus trichocarpa] gi|550330580|gb|ERP56638.1| hypothetical protein POPTR_0010s25360g, partial [Populus trichocarpa] Length = 398 Score = 117 bits (292), Expect = 2e-24 Identities = 57/70 (81%), Positives = 64/70 (91%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIVA++RY+E+ AA VVRQIA GLGALH ANIVHRDLKPENCLFLN+ Sbjct: 110 LVLELCSGGELFDRIVARDRYSESEAAAVVRQIAEGLGALHRANIVHRDLKPENCLFLNE 169 Query: 30 SEGSPLKIMD 1 ++ S LKIMD Sbjct: 170 NDDSTLKIMD 179 >gb|ADV78080.1| calcium- and calmodulin-dependent protein kinase, partial [Conocephalum sp. Qiu 94096] Length = 441 Score = 117 bits (292), Expect = 2e-24 Identities = 56/70 (80%), Positives = 63/70 (90%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIV+QERY+EAGAA V+RQ+ASGL +LH A IVHRDLKPENCLFL Sbjct: 105 LVLELCSGGELFDRIVSQERYSEAGAAEVIRQVASGLASLHQAQIVHRDLKPENCLFLTP 164 Query: 30 SEGSPLKIMD 1 ++ SPLKIMD Sbjct: 165 AQDSPLKIMD 174 >gb|ADV78063.1| calcium- and calmodulin-dependent protein kinase [Treubia lacunosa] Length = 529 Score = 117 bits (292), Expect = 2e-24 Identities = 55/70 (78%), Positives = 65/70 (92%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 L+LELCSGGELFDRIV+QERY+EAGAA V+RQIA+GL +LH+A++VHRDLKPENCLFL Sbjct: 124 LILELCSGGELFDRIVSQERYSEAGAATVIRQIANGLCSLHNAHVVHRDLKPENCLFLTP 183 Query: 30 SEGSPLKIMD 1 +E SPLKIMD Sbjct: 184 AEDSPLKIMD 193 >emb|CBI29153.3| unnamed protein product [Vitis vinifera] Length = 497 Score = 117 bits (292), Expect = 2e-24 Identities = 57/70 (81%), Positives = 63/70 (90%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIVAQ RY+EAGAA VV+Q+A GL ALH ANI+HRDLKPENCLFL+K Sbjct: 96 LVLELCSGGELFDRIVAQARYSEAGAAAVVKQLAEGLKALHQANIIHRDLKPENCLFLDK 155 Query: 30 SEGSPLKIMD 1 SE + LKIMD Sbjct: 156 SEDATLKIMD 165 >ref|XP_002273342.1| PREDICTED: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase DMI-3 [Vitis vinifera] Length = 520 Score = 117 bits (292), Expect = 2e-24 Identities = 57/70 (81%), Positives = 63/70 (90%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIVAQ RY+EAGAA VV+Q+A GL ALH ANI+HRDLKPENCLFL+K Sbjct: 119 LVLELCSGGELFDRIVAQARYSEAGAAAVVKQLAEGLKALHQANIIHRDLKPENCLFLDK 178 Query: 30 SEGSPLKIMD 1 SE + LKIMD Sbjct: 179 SEDATLKIMD 188 >ref|XP_004140929.1| PREDICTED: LOW QUALITY PROTEIN: calcium and calcium/calmodulin-dependent serine/threonine-protein kinase-like [Cucumis sativus] Length = 487 Score = 116 bits (291), Expect = 3e-24 Identities = 59/70 (84%), Positives = 63/70 (90%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIVAQ R+TEA AA VVRQIASGL ALH ANI+HRDLKPENCLFLN+ Sbjct: 117 LVLELCSGGELFDRIVAQTRHTEAKAAEVVRQIASGLKALHEANIIHRDLKPENCLFLNQ 176 Query: 30 SEGSPLKIMD 1 S+ S LKIMD Sbjct: 177 SQDSSLKIMD 186 >gb|ADV78077.1| calcium- and calmodulin-dependent protein kinase, partial [Maianthemum racemosum] Length = 452 Score = 116 bits (291), Expect = 3e-24 Identities = 59/70 (84%), Positives = 61/70 (87%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIV+ ERY E AA VVRQIASGL ALH A+IVHRDLKPENCLFLN Sbjct: 92 LVLELCSGGELFDRIVSHERYAEVDAAQVVRQIASGLDALHKASIVHRDLKPENCLFLNS 151 Query: 30 SEGSPLKIMD 1 SE SPLKIMD Sbjct: 152 SERSPLKIMD 161 >gb|ADV78076.1| calcium- and calmodulin-dependent protein kinase, partial [Ginkgo biloba] Length = 203 Score = 116 bits (291), Expect = 3e-24 Identities = 57/70 (81%), Positives = 60/70 (85%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELCSGGELFDRIVAQERY+EAGAA V+RQI+ GL LH A IVHRDLKPENCLFL Sbjct: 90 LVLELCSGGELFDRIVAQERYSEAGAATVIRQISKGLSGLHDAKIVHRDLKPENCLFLTP 149 Query: 30 SEGSPLKIMD 1 E SPLKIMD Sbjct: 150 DEDSPLKIMD 159 >gb|ADV78062.1| calcium- and calmodulin-dependent protein kinase [Haplomitrium gibbsiae] Length = 527 Score = 116 bits (291), Expect = 3e-24 Identities = 56/70 (80%), Positives = 64/70 (91%) Frame = -2 Query: 210 LVLELCSGGELFDRIVAQERYTEAGAAIVVRQIASGLGALHHANIVHRDLKPENCLFLNK 31 LVLELC+GGELFDRIV+QERY+EAGAA V+RQIA+GL +LHHA IVHRDLKPENCLFL Sbjct: 122 LVLELCTGGELFDRIVSQERYSEAGAAGVIRQIANGLCSLHHAQIVHRDLKPENCLFLTP 181 Query: 30 SEGSPLKIMD 1 +E +PLKIMD Sbjct: 182 AEDAPLKIMD 191