BLASTX nr result
ID: Akebia22_contig00033458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00033458 (291 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN80597.1| hypothetical protein VITISV_002641 [Vitis vinifera] 63 5e-08 ref|XP_002285711.1| PREDICTED: UPF0483 protein AGAP003155 [Vitis... 59 5e-07 ref|XP_004152614.1| PREDICTED: dihydrofolate reductase-like [Cuc... 59 7e-07 ref|XP_007047825.1| Alpha/beta-Hydrolases superfamily protein, p... 58 1e-06 ref|XP_006472521.1| PREDICTED: dihydrofolate reductase-like [Cit... 58 2e-06 ref|XP_006433884.1| hypothetical protein CICLE_v10002399mg [Citr... 58 2e-06 ref|XP_003615240.1| Hydrolase, putative [Medicago truncatula] gi... 57 2e-06 gb|EXC09730.1| hypothetical protein L484_019828 [Morus notabilis] 57 3e-06 ref|XP_003613094.1| Ovarian cancer-associated gene 2 protein-lik... 57 3e-06 ref|XP_004490411.1| PREDICTED: LOW QUALITY PROTEIN: UPF0483 prot... 56 5e-06 ref|XP_002263087.2| PREDICTED: UPF0483 protein AGAP003155-like [... 56 6e-06 emb|CBI18718.3| unnamed protein product [Vitis vinifera] 56 6e-06 ref|XP_006280974.1| hypothetical protein CARUB_v10026973mg [Caps... 55 8e-06 ref|XP_006280973.1| hypothetical protein CARUB_v10026973mg [Caps... 55 8e-06 >emb|CAN80597.1| hypothetical protein VITISV_002641 [Vitis vinifera] Length = 787 Score = 62.8 bits (151), Expect = 5e-08 Identities = 30/50 (60%), Positives = 34/50 (68%) Frame = -1 Query: 261 FFNPKFISILSSIFVLQKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 FF KF+ + Q+ TE FDECLAYIEDYM+ HGPFDG LGFSQ Sbjct: 174 FFEGKFVGF----GLRQEFTEYTNFDECLAYIEDYMIKHGPFDGLLGFSQ 219 >ref|XP_002285711.1| PREDICTED: UPF0483 protein AGAP003155 [Vitis vinifera] gi|302142025|emb|CBI19228.3| unnamed protein product [Vitis vinifera] Length = 226 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 213 QKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 ++ TE FDECLAYIEDYM+ HGPFDG LGFSQ Sbjct: 75 KEFTEYTNFDECLAYIEDYMIKHGPFDGLLGFSQ 108 >ref|XP_004152614.1| PREDICTED: dihydrofolate reductase-like [Cucumis sativus] gi|449527649|ref|XP_004170822.1| PREDICTED: dihydrofolate reductase-like [Cucumis sativus] Length = 249 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -1 Query: 210 KLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 + TE R FDECL++IE+YM+ HGPFDGFLGFSQ Sbjct: 102 EFTEYRNFDECLSFIENYMIKHGPFDGFLGFSQ 134 >ref|XP_007047825.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma cacao] gi|508700086|gb|EOX91982.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma cacao] Length = 234 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 201 ECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 EC F+EC+AYIEDYM+ HGPFDG LGFSQ Sbjct: 76 ECSNFEECIAYIEDYMVKHGPFDGLLGFSQ 105 >ref|XP_006472521.1| PREDICTED: dihydrofolate reductase-like [Citrus sinensis] Length = 223 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 213 QKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 ++ TE FD+CLAYIEDYM+ HGPFDG LGFSQ Sbjct: 74 KEFTEYTNFDKCLAYIEDYMIKHGPFDGLLGFSQ 107 >ref|XP_006433884.1| hypothetical protein CICLE_v10002399mg [Citrus clementina] gi|557536006|gb|ESR47124.1| hypothetical protein CICLE_v10002399mg [Citrus clementina] Length = 223 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 213 QKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 ++ TE FD+CLAYIEDYM+ HGPFDG LGFSQ Sbjct: 74 KEFTEYTNFDKCLAYIEDYMIKHGPFDGLLGFSQ 107 >ref|XP_003615240.1| Hydrolase, putative [Medicago truncatula] gi|355516575|gb|AES98198.1| Hydrolase, putative [Medicago truncatula] gi|388521045|gb|AFK48584.1| unknown [Medicago truncatula] Length = 227 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -1 Query: 213 QKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 ++ TE FDECL YIEDYM+ HGPFDG LGFSQ Sbjct: 73 KEFTEYTNFDECLQYIEDYMIKHGPFDGLLGFSQ 106 >gb|EXC09730.1| hypothetical protein L484_019828 [Morus notabilis] Length = 326 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/34 (70%), Positives = 28/34 (82%) Frame = -1 Query: 213 QKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 Q TE + F+ECL YIEDYM+ +GPFDGFLGFSQ Sbjct: 73 QDFTEYKNFEECLKYIEDYMVKNGPFDGFLGFSQ 106 >ref|XP_003613094.1| Ovarian cancer-associated gene 2 protein-like protein [Medicago truncatula] gi|355514429|gb|AES96052.1| Ovarian cancer-associated gene 2 protein-like protein [Medicago truncatula] Length = 227 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 204 TECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 TE R F+ECLAYIEDYML +GPFDG LGFSQ Sbjct: 75 TEYRNFEECLAYIEDYMLKNGPFDGVLGFSQ 105 >ref|XP_004490411.1| PREDICTED: LOW QUALITY PROTEIN: UPF0483 protein CG5412-like [Cicer arietinum] Length = 242 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = -1 Query: 276 SLILSFFNPKFISILSSIFVLQKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 SL+ F+P + ++ TE FDECL YIED+M+ HGPFDG LGFSQ Sbjct: 62 SLVEGIFDPPYYEWFQ---FNEETTEYYNFDECLQYIEDFMIKHGPFDGLLGFSQ 113 >ref|XP_002263087.2| PREDICTED: UPF0483 protein AGAP003155-like [Vitis vinifera] Length = 206 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -1 Query: 213 QKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 Q TE F+ECLAYIEDYML HGPF G LGFSQ Sbjct: 72 QDFTEYINFEECLAYIEDYMLKHGPFHGLLGFSQ 105 >emb|CBI18718.3| unnamed protein product [Vitis vinifera] Length = 151 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = -1 Query: 213 QKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 Q TE F+ECLAYIEDYML HGPF G LGFSQ Sbjct: 72 QDFTEYINFEECLAYIEDYMLKHGPFHGLLGFSQ 105 >ref|XP_006280974.1| hypothetical protein CARUB_v10026973mg [Capsella rubella] gi|482549678|gb|EOA13872.1| hypothetical protein CARUB_v10026973mg [Capsella rubella] Length = 261 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -1 Query: 261 FFNPKFISILSSIFVLQKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 FF+P + + ++L E + F+ECLAY+EDYM+ +GPFDG LGFSQ Sbjct: 88 FFDPPYYEWYQAN---KELKEYKNFEECLAYVEDYMIKNGPFDGLLGFSQ 134 >ref|XP_006280973.1| hypothetical protein CARUB_v10026973mg [Capsella rubella] gi|482549677|gb|EOA13871.1| hypothetical protein CARUB_v10026973mg [Capsella rubella] Length = 205 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -1 Query: 261 FFNPKFISILSSIFVLQKLTECRKFDECLAYIEDYMLTHGPFDGFLGFSQ 112 FF+P + + ++L E + F+ECLAY+EDYM+ +GPFDG LGFSQ Sbjct: 88 FFDPPYYEWYQAN---KELKEYKNFEECLAYVEDYMIKNGPFDGLLGFSQ 134