BLASTX nr result
ID: Akebia22_contig00033287
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00033287 (255 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD68508.1| hypothetical protein COCSADRAFT_33402 [Bipolaris ... 73 5e-11 gb|EOA84030.1| hypothetical protein SETTUDRAFT_164344 [Setosphae... 71 1e-10 ref|XP_003299390.1| hypothetical protein PTT_10366 [Pyrenophora ... 71 1e-10 ref|XP_007303415.1| hypothetical protein STEHIDRAFT_156100 [Ster... 70 3e-10 gb|EMD96701.1| hypothetical protein COCHEDRAFT_1018530 [Bipolari... 69 7e-10 gb|EUC32573.1| hypothetical protein COCCADRAFT_5757 [Bipolaris z... 68 1e-09 ref|XP_001936772.1| hypothetical protein PTRG_06439 [Pyrenophora... 68 1e-09 gb|EUC41843.1| hypothetical protein COCMIDRAFT_8512 [Bipolaris o... 67 2e-09 gb|EMD00325.1| hypothetical protein BAUCODRAFT_30808 [Baudoinia ... 67 2e-09 gb|EUN22180.1| hypothetical protein COCVIDRAFT_30751 [Bipolaris ... 66 6e-09 ref|XP_007293695.1| hypothetical protein MBM_05806 [Marssonina b... 63 4e-08 ref|XP_001556011.1| predicted protein [Botryotinia fuckeliana B0... 63 4e-08 ref|XP_007303397.1| hypothetical protein STEHIDRAFT_156080 [Ster... 62 6e-08 ref|XP_003713238.1| hypothetical protein MGG_10856 [Magnaporthe ... 62 6e-08 ref|XP_007582403.1| hypothetical protein UCRNP2_3105 [Neofusicoc... 62 8e-08 gb|EYE90808.1| hypothetical protein EURHEDRAFT_381680 [Aspergill... 62 1e-07 gb|EKG12204.1| hypothetical protein MPH_10687 [Macrophomina phas... 62 1e-07 gb|ESZ93580.1| hypothetical protein SBOR_6009 [Sclerotinia borea... 61 1e-07 gb|EHY54480.1| hypothetical protein HMPREF1120_02648 [Exophiala ... 61 2e-07 gb|EXJ59648.1| hypothetical protein A1O7_03794 [Cladophialophora... 60 2e-07 >gb|EMD68508.1| hypothetical protein COCSADRAFT_33402 [Bipolaris sorokiniana ND90Pr] Length = 75 Score = 72.8 bits (177), Expect = 5e-11 Identities = 37/57 (64%), Positives = 43/57 (75%), Gaps = 6/57 (10%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG------VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 QKEDY DK LD +E+K G Q++RG+NEKITD AR MFEKATGK VSDK+SN Sbjct: 19 QKEDYLDKGLDAVEKKYGGASTEDTQRHRGVNEKITDGARNMFEKATGKDVSDKISN 75 >gb|EOA84030.1| hypothetical protein SETTUDRAFT_164344 [Setosphaeria turcica Et28A] Length = 68 Score = 71.2 bits (173), Expect = 1e-10 Identities = 37/57 (64%), Positives = 41/57 (71%), Gaps = 6/57 (10%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG------VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 QKEDY DK LD E+K G Q+NR INEKITD AR MFEKATGKHV +K+SN Sbjct: 12 QKEDYLDKGLDAAEKKYGGSMGQDTQKNRAINEKITDGARNMFEKATGKHVPEKISN 68 >ref|XP_003299390.1| hypothetical protein PTT_10366 [Pyrenophora teres f. teres 0-1] gi|311326973|gb|EFQ92526.1| hypothetical protein PTT_10366 [Pyrenophora teres f. teres 0-1] Length = 84 Score = 71.2 bits (173), Expect = 1e-10 Identities = 35/57 (61%), Positives = 42/57 (73%), Gaps = 6/57 (10%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG------VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 Q+EDY DK LD E+K G ++NRG+NEKITDTAR MFEKATGK + DK+SN Sbjct: 28 QREDYLDKGLDAAEKKWGGAAGQDTEKNRGVNEKITDTARNMFEKATGKDIPDKISN 84 >ref|XP_007303415.1| hypothetical protein STEHIDRAFT_156100 [Stereum hirsutum FP-91666 SS1] gi|389745929|gb|EIM87109.1| hypothetical protein STEHIDRAFT_156100 [Stereum hirsutum FP-91666 SS1] Length = 60 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = -3 Query: 208 KEDYGDKALDKIEQKMGVQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 +EDY DK LD +E+K GV +NRG+NEKITDTAR FE ATG +V KVSN Sbjct: 11 QEDYADKGLDAVEKKEGVPENRGVNEKITDTAREGFESATGDNVPSKVSN 60 >gb|EMD96701.1| hypothetical protein COCHEDRAFT_1018530 [Bipolaris maydis C5] gi|477586484|gb|ENI03568.1| hypothetical protein COCC4DRAFT_32844 [Bipolaris maydis ATCC 48331] Length = 75 Score = 68.9 bits (167), Expect = 7e-10 Identities = 36/57 (63%), Positives = 41/57 (71%), Gaps = 6/57 (10%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG------VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 QKEDY DK LD +E+K G Q+ RG+NEKITD AR MFEKATGK+V DK SN Sbjct: 19 QKEDYLDKGLDAVEKKYGGATAEDTQKYRGVNEKITDGARNMFEKATGKNVPDKFSN 75 >gb|EUC32573.1| hypothetical protein COCCADRAFT_5757 [Bipolaris zeicola 26-R-13] Length = 77 Score = 68.2 bits (165), Expect = 1e-09 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 6/57 (10%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG------VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 QKEDY DK LD +E+K G Q+ RG+NEKITD AR MFEKATGK V DK SN Sbjct: 21 QKEDYLDKGLDAVEKKYGGASTEDTQRYRGVNEKITDGARNMFEKATGKDVPDKFSN 77 >ref|XP_001936772.1| hypothetical protein PTRG_06439 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983871|gb|EDU49359.1| hypothetical protein PTRG_06439 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 81 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/57 (61%), Positives = 41/57 (71%), Gaps = 6/57 (10%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG------VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 Q+EDY DK LD E+K G ++NRG+NEKITD+A MFEKATGK V DKVSN Sbjct: 25 QREDYLDKGLDAAEKKWGGSAGQNTEKNRGVNEKITDSASSMFEKATGKDVPDKVSN 81 >gb|EUC41843.1| hypothetical protein COCMIDRAFT_8512 [Bipolaris oryzae ATCC 44560] Length = 76 Score = 67.4 bits (163), Expect = 2e-09 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 6/57 (10%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG------VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 QKEDY DK LD +E+K G Q+ R +NEKITD AR MFEKATGK V DK+SN Sbjct: 20 QKEDYLDKGLDAVEKKYGGASTEDTQKYRSVNEKITDGARNMFEKATGKDVPDKISN 76 >gb|EMD00325.1| hypothetical protein BAUCODRAFT_30808 [Baudoinia compniacensis UAMH 10762] Length = 68 Score = 67.4 bits (163), Expect = 2e-09 Identities = 37/59 (62%), Positives = 40/59 (67%), Gaps = 8/59 (13%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMGVQQN--------RGINEKITDTARGMFEKATGKHVSDKVSN 59 QKEDY DK LD IE+K+G Q RG NEKITD AR MFEKATGK+V DK SN Sbjct: 10 QKEDYLDKGLDAIEKKVGQQSGHNMDSTKMRGTNEKITDKARDMFEKATGKNVPDKFSN 68 >gb|EUN22180.1| hypothetical protein COCVIDRAFT_30751 [Bipolaris victoriae FI3] Length = 76 Score = 65.9 bits (159), Expect = 6e-09 Identities = 35/57 (61%), Positives = 39/57 (68%), Gaps = 6/57 (10%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG------VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 QKEDY DK LD +E+K G Q+ R +NEKITD AR MFEKATGK V DK SN Sbjct: 20 QKEDYLDKGLDAVEKKYGGASTEDTQRYRSVNEKITDGARNMFEKATGKDVPDKFSN 76 >ref|XP_007293695.1| hypothetical protein MBM_05806 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] gi|406862746|gb|EKD15795.1| hypothetical protein MBM_05806 [Marssonina brunnea f. sp. 'multigermtubi' MB_m1] Length = 84 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/51 (60%), Positives = 37/51 (72%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMGVQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 Q++DYGDKAL+ IE+K G Q G NEKITD RG++EK TGK V K SN Sbjct: 34 QQKDYGDKALEFIEKKTGHQMGAGTNEKITDGLRGLYEKNTGKKVDPKWSN 84 >ref|XP_001556011.1| predicted protein [Botryotinia fuckeliana B05.10] gi|347827055|emb|CCD42752.1| hypothetical protein BofuT4_uP073640.1 [Botryotinia fuckeliana T4] gi|472238612|gb|EMR83470.1| hypothetical protein BcDW1_7904 [Botryotinia fuckeliana BcDW1] Length = 79 Score = 63.2 bits (152), Expect = 4e-08 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = -3 Query: 208 KEDYGDKALDKIEQKMGVQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 KEDYGDKALD IE+K G +R NEKITD ARG++EK TG V+ K SN Sbjct: 30 KEDYGDKALDFIEKKSGHTLSRDQNEKITDGARGLYEKQTGNAVNPKFSN 79 >ref|XP_007303397.1| hypothetical protein STEHIDRAFT_156080 [Stereum hirsutum FP-91666 SS1] gi|389745910|gb|EIM87090.1| hypothetical protein STEHIDRAFT_156080 [Stereum hirsutum FP-91666 SS1] Length = 122 Score = 62.4 bits (150), Expect = 6e-08 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 208 KEDYGDKALDKIEQKMGVQQNRGINEKITDTARGMFEKATG 86 +EDY DK LD E+K G+ QNR +NEK+TD ARG+FEKATG Sbjct: 26 QEDYADKGLDAFEKKEGIPQNRNLNEKVTDGARGLFEKATG 66 >ref|XP_003713238.1| hypothetical protein MGG_10856 [Magnaporthe oryzae 70-15] gi|351645570|gb|EHA53431.1| hypothetical protein MGG_10856 [Magnaporthe oryzae 70-15] gi|440474038|gb|ELQ42806.1| hypothetical protein OOU_Y34scaffold00193g6 [Magnaporthe oryzae Y34] gi|440478340|gb|ELQ59181.1| hypothetical protein OOW_P131scaffold01380g8 [Magnaporthe oryzae P131] Length = 73 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/51 (56%), Positives = 36/51 (70%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMGVQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 +K DYGDKA D + +K G +R +EKITD ARG FEK TGK V+ K+SN Sbjct: 23 EKRDYGDKAFDALAKKSGHPVDRNTSEKITDAARGAFEKVTGKKVNPKISN 73 >ref|XP_007582403.1| hypothetical protein UCRNP2_3105 [Neofusicoccum parvum UCRNP2] gi|485925583|gb|EOD50113.1| hypothetical protein UCRNP2_3105 [Neofusicoccum parvum UCRNP2] Length = 78 Score = 62.0 bits (149), Expect = 8e-08 Identities = 32/57 (56%), Positives = 38/57 (66%), Gaps = 6/57 (10%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG------VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 Q EDY DK LD +E+K G ++NR +NEKITDTAR FE TGK+V DK SN Sbjct: 22 QNEDYLDKGLDSVEKKYGGSMGQNTEKNRAMNEKITDTAREKFESLTGKNVPDKFSN 78 >gb|EYE90808.1| hypothetical protein EURHEDRAFT_381680 [Aspergillus ruber CBS 135680] Length = 83 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/52 (57%), Positives = 35/52 (67%), Gaps = 2/52 (3%) Frame = -3 Query: 208 KEDYGDKALDKIEQKMGVQQN--RGINEKITDTARGMFEKATGKHVSDKVSN 59 +EDY DK LD +E+K G + RG NEKITD R FE TGKHV DK+SN Sbjct: 32 QEDYVDKGLDSVEKKYGADPSKLRGTNEKITDAGRQQFESRTGKHVPDKISN 83 >gb|EKG12204.1| hypothetical protein MPH_10687 [Macrophomina phaseolina MS6] Length = 78 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/57 (56%), Positives = 38/57 (66%), Gaps = 6/57 (10%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG------VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 Q EDY DK LD E+K G Q++R +NEKITD RG FE ATGK+V DK+SN Sbjct: 22 QNEDYLDKGLDAAEKKYGGSWGQDTQKHRAMNEKITDGVRGKFESATGKNVPDKISN 78 >gb|ESZ93580.1| hypothetical protein SBOR_6009 [Sclerotinia borealis F-4157] Length = 85 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/50 (62%), Positives = 35/50 (70%) Frame = -3 Query: 208 KEDYGDKALDKIEQKMGVQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 KEDYGDK LD IE+K G R NEKITD ARG++EK TG V+ K SN Sbjct: 36 KEDYGDKGLDFIEKKTGHTLTREQNEKITDGARGLYEKQTGSAVNSKFSN 85 >gb|EHY54480.1| hypothetical protein HMPREF1120_02648 [Exophiala dermatitidis NIH/UT8656] Length = 67 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/56 (55%), Positives = 38/56 (67%), Gaps = 5/56 (8%) Frame = -3 Query: 211 QKEDYGDKALDKIEQKMG-----VQQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 Q+EDY DK LD +E+K G + R NEKITD ARG+ EKATGK + DK+SN Sbjct: 12 QQEDYLDKGLDAVEKKYGGGKIDPAKQRSTNEKITDKARGLVEKATGKDIPDKISN 67 >gb|EXJ59648.1| hypothetical protein A1O7_03794 [Cladophialophora yegresii CBS 114405] Length = 66 Score = 60.5 bits (145), Expect = 2e-07 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 5/55 (9%) Frame = -3 Query: 208 KEDYGDKALDKIEQKMGV-----QQNRGINEKITDTARGMFEKATGKHVSDKVSN 59 +EDY DK LD E++ G ++R +NEK+TD AR MFEKATGK V DKVSN Sbjct: 12 REDYLDKGLDAAEKRFGQGKIDPAKSRSVNEKVTDKARDMFEKATGKDVPDKVSN 66