BLASTX nr result
ID: Akebia22_contig00033207
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia22_contig00033207 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494311.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_002514235.1| pentatricopeptide repeat-containing protein,... 62 1e-07 ref|XP_002280513.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_006451265.1| hypothetical protein CICLE_v10008215mg [Citr... 59 9e-07 >ref|XP_006494311.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170-like [Citrus sinensis] Length = 471 Score = 64.7 bits (156), Expect = 1e-08 Identities = 33/66 (50%), Positives = 44/66 (66%), Gaps = 7/66 (10%) Frame = +1 Query: 160 RSTSTH-YPPHITLS------DSDQNPAQIIGTHLSKCTNLSDLNQIYAHIIKTCILELR 318 R TH + H+T+S D+ ++PA+I+ T LSKCTNL LNQIYAHII+T +L Sbjct: 24 RLCKTHTFRKHVTISAASSFLDTHEDPAKIVATQLSKCTNLLQLNQIYAHIIRTHMLHSY 83 Query: 319 PSAFHW 336 +AFHW Sbjct: 84 SAAFHW 89 >ref|XP_002514235.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546691|gb|EEF48189.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 352 Score = 61.6 bits (148), Expect = 1e-07 Identities = 43/99 (43%), Positives = 53/99 (53%) Frame = +1 Query: 40 MISFHHLFVKVSVRTKRSNCLSLMVTQHLNHKLNLHFEAQRSTSTHYPPHITLSDSDQNP 219 M S HHLF+ + R K S +L ++ HLNH L F A T PP L S Q+ Sbjct: 1 MNSLHHLFL-LGFR-KSSTFKNLTISCHLNHSLAF-FSASSDAQT--PP---LPQSAQDI 52 Query: 220 AQIIGTHLSKCTNLSDLNQIYAHIIKTCILELRPSAFHW 336 A+ T S CT L DLNQIYAHII + +L + FHW Sbjct: 53 AKWAATQSSNCTTLRDLNQIYAHIICSDLLHFYSAPFHW 91 >ref|XP_002280513.1| PREDICTED: pentatricopeptide repeat-containing protein At1g77170 [Vitis vinifera] gi|297738768|emb|CBI28013.3| unnamed protein product [Vitis vinifera] Length = 479 Score = 59.7 bits (143), Expect = 4e-07 Identities = 39/103 (37%), Positives = 56/103 (54%), Gaps = 4/103 (3%) Frame = +1 Query: 40 MISFHHLFVKVS-VRTKRSNCLSLMVTQHL---NHKLNLHFEAQRSTSTHYPPHITLSDS 207 M SF +++S V+ + +S + +L H ++ F Q T +PP D Sbjct: 1 MTSFQPPLLRLSIVQIPKPQTISRHLCNYLATTTHSVDAQFNFQ---PTAHPPS---PDP 54 Query: 208 DQNPAQIIGTHLSKCTNLSDLNQIYAHIIKTCILELRPSAFHW 336 Q+ AQ I +HLSKC NL +LNQ+ AHII+T LEL P+ F W Sbjct: 55 IQDTAQTIASHLSKCANLIELNQLLAHIIRTHFLELYPAPFQW 97 >ref|XP_006451265.1| hypothetical protein CICLE_v10008215mg [Citrus clementina] gi|557554491|gb|ESR64505.1| hypothetical protein CICLE_v10008215mg [Citrus clementina] Length = 461 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +1 Query: 214 NPAQIIGTHLSKCTNLSDLNQIYAHIIKTCILELRPSAFHW 336 +PA+I+ T LSKCTNL LNQIYAHII+T +L +AFHW Sbjct: 39 HPAKIVATQLSKCTNLLQLNQIYAHIIRTHMLHSYSAAFHW 79